(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE375

PENCW_10.PE375       Location/Qualifiers
FT   CDS             join(complement(885890..886021),complement(885669..885816),
FT                   complement(885456..885589))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978326"
FT                   /orf_name="Pc13g03750"
FT                   /product="Putative uncharacterized protein Pc13g03750 "
FT                   /protein_id="CAP91444.1"
FT                   /db_xref="UniParc:UPI00018306BD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H222"
FT                   /transl_table=1
FT                   /translation="MSAKLNPGEMCLFGVWAFEPRRFAYGSANPYLSWRVCAWPGRIKN
FT                   WPGVAQVALVSRLSEQRYIRGVKASSISATYLQNIFWHTPSAEEVDIPVGMPSINSKFL
FT                   NPFATFATSFCTGECPNAHCSETKSDGGDKRQG"
     MSAKLNPGEM CLFGVWAFEP RRFAYGSANP YLSWRVCAWP GRIKNWPGVA QVALVSRLSE        60
     QRYIRGVKAS SISATYLQNI FWHTPSAEEV DIPVGMPSIN SKFLNPFATF ATSFCTGECP       120
     NAHCSETKSD GGDKRQG                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page