(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE376

PENCW_10.PE376       Location/Qualifiers
FT   CDS             join(887007..887163,887214..887271,887338..887344,
FT                   887397..887557,887607..888936)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978327"
FT                   /orf_name="Pc13g03760"
FT                   /product="Pc13g03760 protein"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91445.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI00018306BE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H232"
FT                   /transl_table=1
FT                   /translation="MEKSIKAEEYPDHTVAREFSEDGKIEQGQSGLNDPNHVELHRALK
FT                   ARHITMIAIGGAIGTGLIIGTGEALAKAGPGAILISYAWVGFIVFLVMCALGEMAAWLP
FT                   LPSGFTGYAVRFVDPALGFTLGWTYWFKYIILSPNQMTAGAMVISYWIPPEKVNAGVWI
FT                   TIFLVIVVAINYFGVKFFGEFEFWLSSFKVIVILGIILMSFILMLGGGPDHDRKGFRYW
FT                   KEPGAFNTYKMDGAPGRFLAFWSTMVSATFAYLGTELVGVTVGEAQNPRKTIPRAIKLT
FT                   FYRILVFYVTSVLLVGTLVPYNSPKLLFALSDDNKKKGSAAASPFVVAIELAAIPILPH
FT                   ILNACILLFVFSAANSDLYIATRTIYGLAREGKAPKIFARTDRRGVPVPALAISSIIAL
FT                   LGYMNVSSDSKTVFKYFVNLVTIFGLLTWISILVTHIYFVRARKAQGVPEESLAYKAPL
FT                   GVAGSYFALGFCILIAFTKNFDVFIHNPKTYGNFDYKNFITAYLGIPLYLIMIFGYKFA
FT                   TGSKGVDPMTADLFTGKDEIDREEALYLARKEAETEKHNNAGWFYRTFVSWLF"
     MEKSIKAEEY PDHTVAREFS EDGKIEQGQS GLNDPNHVEL HRALKARHIT MIAIGGAIGT        60
     GLIIGTGEAL AKAGPGAILI SYAWVGFIVF LVMCALGEMA AWLPLPSGFT GYAVRFVDPA       120
     LGFTLGWTYW FKYIILSPNQ MTAGAMVISY WIPPEKVNAG VWITIFLVIV VAINYFGVKF       180
     FGEFEFWLSS FKVIVILGII LMSFILMLGG GPDHDRKGFR YWKEPGAFNT YKMDGAPGRF       240
     LAFWSTMVSA TFAYLGTELV GVTVGEAQNP RKTIPRAIKL TFYRILVFYV TSVLLVGTLV       300
     PYNSPKLLFA LSDDNKKKGS AAASPFVVAI ELAAIPILPH ILNACILLFV FSAANSDLYI       360
     ATRTIYGLAR EGKAPKIFAR TDRRGVPVPA LAISSIIALL GYMNVSSDSK TVFKYFVNLV       420
     TIFGLLTWIS ILVTHIYFVR ARKAQGVPEE SLAYKAPLGV AGSYFALGFC ILIAFTKNFD       480
     VFIHNPKTYG NFDYKNFITA YLGIPLYLIM IFGYKFATGS KGVDPMTADL FTGKDEIDRE       540
     EALYLARKEA ETEKHNNAGW FYRTFVSWLF                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page