(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE377

PENCW_10.PE377       Location/Qualifiers
FT   CDS             join(complement(890839..891213),complement(889594..890787))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000214206" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950882"
FT                   /orf_name="Pc13g03770"
FT                   /product="Pc13g03770 protein"
FT                   /function="metallocarboxypeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAP91446.1"
FT                   /db_xref="GO:0004181"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="UniParc:UPI00018306BF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H233"
FT                   /transl_table=1
FT                   /translation="MRLFSPILVASTLIPLISAVPAGSSITPPPPLQPSYFTHSSPRPW
FT                   ARLRDWIIGSIWDIDHKHRSSKHSSPPSNIHDRYGSDVVLRFHLRQPDEAEALASASQV
FT                   LFLDIWAITSEFVDIRLADDMIPSLLDLLPLTLRTSYTPLMDNLADEIYASYPSRHRSD
FT                   SDFKSGLASAELKTISNCDLFFQEYQPLSVITQWMRLMASMFSSHVRMTSVGVSYEGRD
FT                   IPALRLGTSHNTETTSGPRKTILIVGGSHAREWISTSTVTYVAYSLITHYGYSPAVTRL
FT                   LHEYDWVLIPTINPDGYVYSWESDRLWRKNRQPTGLPLCPGVDLDRAWDYEWDGESTRS
FT                   NPCSENYAGAEPFEALESQRLAQWAQNQTAHGGAEIVGFLDLHSYSQQILYPYSYSCSS
FT                   VPPTLESLEELALGLAKAIRQTSHESYDVTSACEGILTQGAAAGITSGGSALDWFYHKL
FT                   HTRFSYQIKLRDRGSYGFLLPSEHIVPTGKEIFRALLTFGKFVWGEEASDISLEDMTGD
FT                   QIPLN"
     MRLFSPILVA STLIPLISAV PAGSSITPPP PLQPSYFTHS SPRPWARLRD WIIGSIWDID        60
     HKHRSSKHSS PPSNIHDRYG SDVVLRFHLR QPDEAEALAS ASQVLFLDIW AITSEFVDIR       120
     LADDMIPSLL DLLPLTLRTS YTPLMDNLAD EIYASYPSRH RSDSDFKSGL ASAELKTISN       180
     CDLFFQEYQP LSVITQWMRL MASMFSSHVR MTSVGVSYEG RDIPALRLGT SHNTETTSGP       240
     RKTILIVGGS HAREWISTST VTYVAYSLIT HYGYSPAVTR LLHEYDWVLI PTINPDGYVY       300
     SWESDRLWRK NRQPTGLPLC PGVDLDRAWD YEWDGESTRS NPCSENYAGA EPFEALESQR       360
     LAQWAQNQTA HGGAEIVGFL DLHSYSQQIL YPYSYSCSSV PPTLESLEEL ALGLAKAIRQ       420
     TSHESYDVTS ACEGILTQGA AAGITSGGSA LDWFYHKLHT RFSYQIKLRD RGSYGFLLPS       480
     EHIVPTGKEI FRALLTFGKF VWGEEASDIS LEDMTGDQIP LN                          522
//

If you have problems or comments...

PBIL Back to PBIL home page