(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE378

PENCW_10.PE378       Location/Qualifiers
FT   CDS             join(892017..892383,892452..896281)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214195" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129524"
FT                   /orf_name="Pc13g03780"
FT                   /product="Pc13g03780 protein"
FT                   /function="ARF guanyl-nucleotide exchange factor activity "
FT                   /biological_process="regulation of ARF protein signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP91447.1"
FT                   /db_xref="GO:0005086"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032012"
FT                   /db_xref="InterPro:IPR000904"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniParc:UPI000183077D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H234"
FT                   /transl_table=1
FT                   /translation="MHWKGLRLVADGKRQSTMEPQGQSRRSEHLPRPYPPAEPRLSESI
FT                   PRTPGLSESVNPELPAPDDNGSNHGVAQPDFAGPSSDRSSVRHKRFSFMRLRHASDPQL
FT                   SKSYVRAGQDTPPVPSLPPPKIITTAPTSQELDQPVKQRPRLSFRPSSRKQSMEEMSRR
FT                   SMEQPAKPRRRGQGSTDSQVTDSTLAMSQSITEEPGRLSTNSLRGNPQPNDSQRSSVID
FT                   PRFSESSRSDQSYGDQTITRSISPRDGQSATAAKRFRMPRLKRTRSPLFPLPPKVSHPT
FT                   GVVDNRPKFAPADTPKSETLDGHDHVSPLPSPSRSTVGLAASSNVTPLFRNDSTNSARS
FT                   VRSNPSLKNRGRSSTMGSLAENHDDLSIPPYLASSARTSTSTSGRKSFGDMFNITQRLR
FT                   QNSSPPSPRHGSPTIGGASTPISKQELPTIPKREESDTPASYLTRLEENIPRGMIAGVL
FT                   AQSDEEFYKVCLRKYMRTFSYFGDPLDMSIRKLLMEVELPKETQQIDRFVQAFADRYHE
FT                   CNPGIFTAPDNAYFIAFSLLILHTDVFNKNNKRKMQKADYVKISRSEGISEDILECFYE
FT                   NISYTPFIRVEDANLPDRHLAKPRRTLFKSTSSENLARIAREPVDPYSLILEGKLGSLR
FT                   PSLKDVMDLEDTYNHFGTAGPPDMDALHQAFTKSGILQIISLRSRPDAFMPASLGSPLD
FT                   SNPGLVDIKVAKVGLLWRKDPKKKKARSPWQEWGAILTFSQLYFFRNVNWVRSLMAQHE
FT                   AYVKNGRRGTLVFKPPLAEFKPDNIVSTGDTVALLDSSYKKHKHAFIFVRHNALEETFL
FT                   ASTESEMNDWLAHLNYAAAFRTTGVRTKGMIATNYEGQRYRKSQRLSSISSQKSHQSTD
FT                   IEPHSPSIDTDIVAEFVAARQQLMSQKIRERNEKLAMSQKQLDDLLQNARHLQVLTPLH
FT                   ARARENVIMAAGRLSAKIKWVRQDIWRSKCYRQVLLRDLGEDEEAVESRVGSVAEPTPS
FT                   HSDGARLASLSGPSVTSEPSVEKAGSIVHTVSSADTPEPNMAQTEQPSEAGLLPKPSND
FT                   ELRRPSIPGSATSADIARVGRRRSAVALPERAKSYSPDPATIKLEREASVLSRASRWDG
FT                   ASLASRTSKLTTPVSFDDGEERVLREAGLLELPASPSTQKDDETASNGLPGKDTEGETN
FT                   PKDKSDRPSRVRRSLHRTLRDSHAHRTHSHSKKKRGSVSSIGQEEDDQVSGDGEVLPRK
FT                   APSFTVHGKKASIVTFGSEWQNMPPEERLKLRKPTPHEESRVSDPAILDSGESIMTDRS
FT                   PERPHSARRMSTATGLSVRTSDDPADFTDAQEEQEEQPEEDIGAPGSPVVTSLPTPHPL
FT                   DTQHTPYSPSSTIYGHLSAPRHDGSPSPSPSSTSISERIVDTPSSENLREQAVGA"
     MHWKGLRLVA DGKRQSTMEP QGQSRRSEHL PRPYPPAEPR LSESIPRTPG LSESVNPELP        60
     APDDNGSNHG VAQPDFAGPS SDRSSVRHKR FSFMRLRHAS DPQLSKSYVR AGQDTPPVPS       120
     LPPPKIITTA PTSQELDQPV KQRPRLSFRP SSRKQSMEEM SRRSMEQPAK PRRRGQGSTD       180
     SQVTDSTLAM SQSITEEPGR LSTNSLRGNP QPNDSQRSSV IDPRFSESSR SDQSYGDQTI       240
     TRSISPRDGQ SATAAKRFRM PRLKRTRSPL FPLPPKVSHP TGVVDNRPKF APADTPKSET       300
     LDGHDHVSPL PSPSRSTVGL AASSNVTPLF RNDSTNSARS VRSNPSLKNR GRSSTMGSLA       360
     ENHDDLSIPP YLASSARTST STSGRKSFGD MFNITQRLRQ NSSPPSPRHG SPTIGGASTP       420
     ISKQELPTIP KREESDTPAS YLTRLEENIP RGMIAGVLAQ SDEEFYKVCL RKYMRTFSYF       480
     GDPLDMSIRK LLMEVELPKE TQQIDRFVQA FADRYHECNP GIFTAPDNAY FIAFSLLILH       540
     TDVFNKNNKR KMQKADYVKI SRSEGISEDI LECFYENISY TPFIRVEDAN LPDRHLAKPR       600
     RTLFKSTSSE NLARIAREPV DPYSLILEGK LGSLRPSLKD VMDLEDTYNH FGTAGPPDMD       660
     ALHQAFTKSG ILQIISLRSR PDAFMPASLG SPLDSNPGLV DIKVAKVGLL WRKDPKKKKA       720
     RSPWQEWGAI LTFSQLYFFR NVNWVRSLMA QHEAYVKNGR RGTLVFKPPL AEFKPDNIVS       780
     TGDTVALLDS SYKKHKHAFI FVRHNALEET FLASTESEMN DWLAHLNYAA AFRTTGVRTK       840
     GMIATNYEGQ RYRKSQRLSS ISSQKSHQST DIEPHSPSID TDIVAEFVAA RQQLMSQKIR       900
     ERNEKLAMSQ KQLDDLLQNA RHLQVLTPLH ARARENVIMA AGRLSAKIKW VRQDIWRSKC       960
     YRQVLLRDLG EDEEAVESRV GSVAEPTPSH SDGARLASLS GPSVTSEPSV EKAGSIVHTV      1020
     SSADTPEPNM AQTEQPSEAG LLPKPSNDEL RRPSIPGSAT SADIARVGRR RSAVALPERA      1080
     KSYSPDPATI KLEREASVLS RASRWDGASL ASRTSKLTTP VSFDDGEERV LREAGLLELP      1140
     ASPSTQKDDE TASNGLPGKD TEGETNPKDK SDRPSRVRRS LHRTLRDSHA HRTHSHSKKK      1200
     RGSVSSIGQE EDDQVSGDGE VLPRKAPSFT VHGKKASIVT FGSEWQNMPP EERLKLRKPT      1260
     PHEESRVSDP AILDSGESIM TDRSPERPHS ARRMSTATGL SVRTSDDPAD FTDAQEEQEE      1320
     QPEEDIGAPG SPVVTSLPTP HPLDTQHTPY SPSSTIYGHL SAPRHDGSPS PSPSSTSISE      1380
     RIVDTPSSEN LREQAVGA                                                    1398
//

If you have problems or comments...

PBIL Back to PBIL home page