(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE379

PENCW_10.PE379       Location/Qualifiers
FT   CDS             join(897002..897553,897635..897890,897948..898279)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214173" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672462"
FT                   /orf_name="Pc13g03790"
FT                   /product="Pc13g03790 protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP91448.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniParc:UPI000183077E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H235"
FT                   /transl_table=1
FT                   /translation="MAHSKRNTSLPHFTSYERGLLRSTWGTKRSAIGRDSFLSFGSCRL
FT                   CLQPARAPVVACASNGDLFCRECAISDLLAQRQEIKRLEKERDEARKRIAGDEERSLAE
FT                   MKERDLRDFELVSMGLENKGGSGVGTKRKAEESEALEKFKAREVEVDGKRKRVFELGEE
FT                   EMARVAGEEKERLRKELKMEKSSSKSALPSFWVPSLTPNTDANEIAANKTVKLTPVCPG
FT                   STDESRHSYSLKSLVEVNFTEEKASDGTVSRVCPSCKKNLSNGLKAMLTKPCGHVICSP
FT                   CVTKFMIPHDHHIPDPHASKEEQEKNAALHGQVLCYVCETDVTAKSTPDGNGSGNNKKS
FT                   KKKDKDAIQPGLVEVSSEGTGFASKGGNMGKKTGVAFQC"
     MAHSKRNTSL PHFTSYERGL LRSTWGTKRS AIGRDSFLSF GSCRLCLQPA RAPVVACASN        60
     GDLFCRECAI SDLLAQRQEI KRLEKERDEA RKRIAGDEER SLAEMKERDL RDFELVSMGL       120
     ENKGGSGVGT KRKAEESEAL EKFKAREVEV DGKRKRVFEL GEEEMARVAG EEKERLRKEL       180
     KMEKSSSKSA LPSFWVPSLT PNTDANEIAA NKTVKLTPVC PGSTDESRHS YSLKSLVEVN       240
     FTEEKASDGT VSRVCPSCKK NLSNGLKAML TKPCGHVICS PCVTKFMIPH DHHIPDPHAS       300
     KEEQEKNAAL HGQVLCYVCE TDVTAKSTPD GNGSGNNKKS KKKDKDAIQP GLVEVSSEGT       360
     GFASKGGNMG KKTGVAFQC                                                    379
//

If you have problems or comments...

PBIL Back to PBIL home page