(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE38

PENCW_10.PE38        Location/Qualifiers
FT   CDS             complement(90182..90601)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076506" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948693"
FT                   /orf_name="Pc13g00380"
FT                   /product="Putative uncharacterized protein Pc13g00380 "
FT                   /protein_id="CAP91107.1"
FT                   /db_xref="UniParc:UPI0001830DCA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H183"
FT                   /transl_table=1
FT                   /translation="MEEIVDIVRQIGRQQGENVYFRTCYALFKHLQDKAEQASQDLLHL
FT                   HQSGAFGSSDDEFYPVYQVAQELQVSVHELAEQALKAQLACEEFCQLDPSYSAREAFKF
FT                   TDTVHTAGKTEADASQGVCDSPRSMRFIMLPVNDL"
     MEEIVDIVRQ IGRQQGENVY FRTCYALFKH LQDKAEQASQ DLLHLHQSGA FGSSDDEFYP        60
     VYQVAQELQV SVHELAEQAL KAQLACEEFC QLDPSYSARE AFKFTDTVHT AGKTEADASQ       120
     GVCDSPRSMR FIMLPVNDL                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page