(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE380

PENCW_10.PE380       Location/Qualifiers
FT   CDS             complement(898483..899466)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000214172" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129525"
FT                   /orf_name="Pc13g03800"
FT                   /product="Pc13g03800 protein"
FT                   /function="hydrolase activity"
FT                   /function="metal ion binding"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAP91449.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="InterPro:IPR001604"
FT                   /db_xref="InterPro:IPR018524"
FT                   /db_xref="InterPro:IPR020821"
FT                   /db_xref="UniParc:UPI000183077F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H231"
FT                   /transl_table=1
FT                   /translation="MSKATLAVIAAASAATGAGVTALLFSGKPSKPQQETLSPTPTTQN
FT                   PKVPVPSTIPSPTLASKLATGPVDAAGILQYGFPGPIADELSSLPLHGAYDRRTRNPSW
FT                   VAEHITPESLRMNNADRKRSTFFEDTTIPAMFRAKLSDYFRSGYDRGHQVPAADAKWSQ
FT                   DAMDGTFALSNMSPQVGEGFNRDYWAHFENFCRDLAKRYPSVRIVTGPLYLPHRDPDGK
FT                   WRVNYEVIGNPPNVAVPTHFYKVIYAEDGTNSPTSKVALGAFVLPNARIANDKRLTDFE
FT                   VPLEAVERASGLEFGSKLDLSRRRRLCQEVSCSITVREFNNANKRS"
     MSKATLAVIA AASAATGAGV TALLFSGKPS KPQQETLSPT PTTQNPKVPV PSTIPSPTLA        60
     SKLATGPVDA AGILQYGFPG PIADELSSLP LHGAYDRRTR NPSWVAEHIT PESLRMNNAD       120
     RKRSTFFEDT TIPAMFRAKL SDYFRSGYDR GHQVPAADAK WSQDAMDGTF ALSNMSPQVG       180
     EGFNRDYWAH FENFCRDLAK RYPSVRIVTG PLYLPHRDPD GKWRVNYEVI GNPPNVAVPT       240
     HFYKVIYAED GTNSPTSKVA LGAFVLPNAR IANDKRLTDF EVPLEAVERA SGLEFGSKLD       300
     LSRRRRLCQE VSCSITVREF NNANKRS                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page