(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE382

PENCW_10.PE382       Location/Qualifiers
FT   CDS             join(complement(902888..903013),complement(902515..902619),
FT                   complement(902381..902470))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672463"
FT                   /orf_name="Pc13g03820"
FT                   /product="Putative uncharacterized protein Pc13g03820 "
FT                   /protein_id="CAP91451.1"
FT                   /db_xref="UniParc:UPI0001830780"
FT                   /db_xref="UniProtKB/TrEMBL:B6H223"
FT                   /transl_table=1
FT                   /translation="MLKLPTSGRPTAWSATTTSRLACQFRFSASYMAAGWLEDSAIAPP
FT                   RGDALSVDEICSVGTPWCKESDKVNYDPDSKQRNVVTARVLPIMTYHVPDIVLGRWQNL
FT                   TA"
     MLKLPTSGRP TAWSATTTSR LACQFRFSAS YMAAGWLEDS AIAPPRGDAL SVDEICSVGT        60
     PWCKESDKVN YDPDSKQRNV VTARVLPIMT YHVPDIVLGR WQNLTA                      106
//

If you have problems or comments...

PBIL Back to PBIL home page