(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE383

PENCW_10.PE383       Location/Qualifiers
FT   CDS             join(903427..904204,904234..904370)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825159"
FT                   /orf_name="Pc13g03830"
FT                   /product="Putative uncharacterized protein Pc13g03830 "
FT                   /protein_id="CAP91452.1"
FT                   /db_xref="UniParc:UPI0001830781"
FT                   /db_xref="UniProtKB/TrEMBL:B6H224"
FT                   /transl_table=1
FT                   /translation="MNGQLPPYYALETILSELSEVPELSGFIVVKDNELNAIEKPAETI
FT                   TIIDFYRYSTAILDYVKSSNTDSLALHTEALDSWGTEIICILLTNLHAKSVPSPFCALL
FT                   SGFPFTKTWNRFVEYYLADPGVEFPREKFPDAKALAEATLRQFSRRNLRAVTRFGVGAI
FT                   IRPVEATYQDEFYRSLHTVLGYAMNVTSEWSPDGVGRIDFRLSSVRWGIELLREGDRLH
FT                   DHCQRFTTDGAYGKWIQQGLLEDWLVIDCRTSSPRSYAGTAHASIEIPDTKLWRAVFAP
FT                   DFSDVEVRDQYNQVVVDRFALTE"
     MNGQLPPYYA LETILSELSE VPELSGFIVV KDNELNAIEK PAETITIIDF YRYSTAILDY        60
     VKSSNTDSLA LHTEALDSWG TEIICILLTN LHAKSVPSPF CALLSGFPFT KTWNRFVEYY       120
     LADPGVEFPR EKFPDAKALA EATLRQFSRR NLRAVTRFGV GAIIRPVEAT YQDEFYRSLH       180
     TVLGYAMNVT SEWSPDGVGR IDFRLSSVRW GIELLREGDR LHDHCQRFTT DGAYGKWIQQ       240
     GLLEDWLVID CRTSSPRSYA GTAHASIEIP DTKLWRAVFA PDFSDVEVRD QYNQVVVDRF       300
     ALTE                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page