(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE384

PENCW_10.PE384       Location/Qualifiers
FT   CDS             join(complement(910023..910473),complement(907667..909970),
FT                   complement(904935..907582))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213293" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950883"
FT                   /orf_name="Pc13g03840"
FT                   /product="Pc13g03840 protein"
FT                   /protein_id="CAP91453.1"
FT                   /db_xref="UniParc:UPI0001830782"
FT                   /db_xref="UniProtKB/TrEMBL:B6H225"
FT                   /transl_table=1
FT                   /translation="MVSSTAISCVEGFKSKESDQVIGRNVDAAFVTYAKRFSTHWNCVV
FT                   DAHTAKLVQDSPLIYSSPELGSLRQFLGVQDRPLQFILDSRAHSLAEGSFEWFNNTLYD
FT                   FSVGSSPAMLVSGGPGSGKSALAQWAVERLQQSAEHDSWNVIPYTIRADIPVATLPLRI
FT                   LKGVLHQMLDHSVSDKQTQEAILAEVARAAQGAIDGAGDDAVEASLWRGIRAGLATNIQ
FT                   YMFVVDGIDQIRGGHANAVAYLDRFCEILSEQNAGSKMIAFTRPLTSKVSSKGVHQLTL
FT                   QTSQTKTDLVAYVNKMLASSANFDTHKGNQLQAAVSAIVARSQGSFSWAEMAVSYAKQQ
FT                   KTLSQAVASIQALPQSMSELIDFHSKSLDFSQQGTVNVVSWLVAAERPLLVEEIEHLLN
FT                   VDPKGPSYSPNQSTSSYDILNALSPLVMTRDGVVSFAHTCIRDHVIKQAKSSGGQSKLS
FT                   IRDAHYDLLTRCLSSVHLNVREEVDISMDRLGIEERNHLFDKYVVLEYTARYWLSHLLS
FT                   SPLVTDDEEFQFNSSFWKIMPATVLFARLELTCRESQFTRSSVVELYRLASDIRRLVLG
FT                   EKSIALLQSLVLSARVSKLAHASHADETCYEAWKLSQELLGQSHPVTLSCSEMMVQSFS
FT                   ERGTITSQQEDIMKYLILTDSEITGVEFNQRLKYLGMIVSMYKSRNDNQSALFISKHFY
FT                   QQILQKYGTNSRQSSETADFLTSHFSTTGTDEMSRDIARTKYDNMVRTMEVTDERRISY
FT                   TLYMAKMYEDQGDLAHAQAVLSSLWAGLNSRDIDSVDMMDKKANVALVYYQFLRRQGRN
FT                   DESEVIIRELVADLEVTGIHSEEMMQRVHLLRAETREMLMYNLDRSLAILMWRYYKETH
FT                   QEYSEDSTALALSIAQSMANAVSIESASSLSSRDRKLLIELLDVISATSECAMAVLQHI
FT                   WPAVEQAKSHQKFSPELAPPAADLALVLAYCHFRRLHLEQATAVYENAFGSLISSAGVP
FT                   VPSVMAVAKAVVEFHETTYQFTNALTLLHTMSNFLAARLGEKHEHTIENMYSEAALATR
FT                   LEKNSEAKSIYQRIFNATSHQNTVSPEGMDAAIALINLYEKEMQWDSALHVYRSLWPTL
FT                   VVEDNKVDTYDHDLVDRMLEKTYLGYMSILTTHKRADFSERYRVASEYVMTCRHLHGAT
FT                   SEKTLNATLLFAELCESNDAHVDQAISLYKLPLETSEWVAPSQSSKGLDQMTTPLPITL
FT                   KHKLAQLFVRKHDSTVEARSLYTEEFQLAKKNQGYFSTTTLSWLRELALAHSRQGTSTS
FT                   VQQGNAILHAYSTDVLHAGGDTETIGDWARRIASIYLECGFIEGGNNLLDELRHRVVYG
FT                   SESSAVDLSDRRDAVFVAAFEEVFGRRASYDQIMAEMAREMRTSQAFSKSLSSHDFIPT
FT                   LITGHKLYNLQISQKRVRAANDTKDKLYDYFCSNLSATNVADKEIVQQFYQICLREVHR
FT                   ENCNMSILTTTTNLVRDLCNSSRFQEASILTGVLHSFLHLTDGLNNQESINTATQLCLY
FT                   LSGHKANKCTDEKTYQAISTKSKLLLQEIMATSKSMGIEMVDLPFNHLNDIITLLGQYE
FT                   MFDELEAILTQLWTSRIVQRTWTPDVVVWIGRRLVETRFCRGSVDSAIQLCRDICYNLR
FT                   QVWGSCDPVTLDMTKLLSALFTASENYQSAATLHEGILYDLLGDSGAVDHANGADTASQ
FT                   HMELLRRSQARLGAEQTSSRPSAHAELFQSVADRFGVQSEQIKSVGEANGGEQFGVWSK
FT                   PRRFSIDVEDMEEEGQTHRNHLRESSGAGLGGTGSQRRISVQAL"
     MVSSTAISCV EGFKSKESDQ VIGRNVDAAF VTYAKRFSTH WNCVVDAHTA KLVQDSPLIY        60
     SSPELGSLRQ FLGVQDRPLQ FILDSRAHSL AEGSFEWFNN TLYDFSVGSS PAMLVSGGPG       120
     SGKSALAQWA VERLQQSAEH DSWNVIPYTI RADIPVATLP LRILKGVLHQ MLDHSVSDKQ       180
     TQEAILAEVA RAAQGAIDGA GDDAVEASLW RGIRAGLATN IQYMFVVDGI DQIRGGHANA       240
     VAYLDRFCEI LSEQNAGSKM IAFTRPLTSK VSSKGVHQLT LQTSQTKTDL VAYVNKMLAS       300
     SANFDTHKGN QLQAAVSAIV ARSQGSFSWA EMAVSYAKQQ KTLSQAVASI QALPQSMSEL       360
     IDFHSKSLDF SQQGTVNVVS WLVAAERPLL VEEIEHLLNV DPKGPSYSPN QSTSSYDILN       420
     ALSPLVMTRD GVVSFAHTCI RDHVIKQAKS SGGQSKLSIR DAHYDLLTRC LSSVHLNVRE       480
     EVDISMDRLG IEERNHLFDK YVVLEYTARY WLSHLLSSPL VTDDEEFQFN SSFWKIMPAT       540
     VLFARLELTC RESQFTRSSV VELYRLASDI RRLVLGEKSI ALLQSLVLSA RVSKLAHASH       600
     ADETCYEAWK LSQELLGQSH PVTLSCSEMM VQSFSERGTI TSQQEDIMKY LILTDSEITG       660
     VEFNQRLKYL GMIVSMYKSR NDNQSALFIS KHFYQQILQK YGTNSRQSSE TADFLTSHFS       720
     TTGTDEMSRD IARTKYDNMV RTMEVTDERR ISYTLYMAKM YEDQGDLAHA QAVLSSLWAG       780
     LNSRDIDSVD MMDKKANVAL VYYQFLRRQG RNDESEVIIR ELVADLEVTG IHSEEMMQRV       840
     HLLRAETREM LMYNLDRSLA ILMWRYYKET HQEYSEDSTA LALSIAQSMA NAVSIESASS       900
     LSSRDRKLLI ELLDVISATS ECAMAVLQHI WPAVEQAKSH QKFSPELAPP AADLALVLAY       960
     CHFRRLHLEQ ATAVYENAFG SLISSAGVPV PSVMAVAKAV VEFHETTYQF TNALTLLHTM      1020
     SNFLAARLGE KHEHTIENMY SEAALATRLE KNSEAKSIYQ RIFNATSHQN TVSPEGMDAA      1080
     IALINLYEKE MQWDSALHVY RSLWPTLVVE DNKVDTYDHD LVDRMLEKTY LGYMSILTTH      1140
     KRADFSERYR VASEYVMTCR HLHGATSEKT LNATLLFAEL CESNDAHVDQ AISLYKLPLE      1200
     TSEWVAPSQS SKGLDQMTTP LPITLKHKLA QLFVRKHDST VEARSLYTEE FQLAKKNQGY      1260
     FSTTTLSWLR ELALAHSRQG TSTSVQQGNA ILHAYSTDVL HAGGDTETIG DWARRIASIY      1320
     LECGFIEGGN NLLDELRHRV VYGSESSAVD LSDRRDAVFV AAFEEVFGRR ASYDQIMAEM      1380
     AREMRTSQAF SKSLSSHDFI PTLITGHKLY NLQISQKRVR AANDTKDKLY DYFCSNLSAT      1440
     NVADKEIVQQ FYQICLREVH RENCNMSILT TTTNLVRDLC NSSRFQEASI LTGVLHSFLH      1500
     LTDGLNNQES INTATQLCLY LSGHKANKCT DEKTYQAIST KSKLLLQEIM ATSKSMGIEM      1560
     VDLPFNHLND IITLLGQYEM FDELEAILTQ LWTSRIVQRT WTPDVVVWIG RRLVETRFCR      1620
     GSVDSAIQLC RDICYNLRQV WGSCDPVTLD MTKLLSALFT ASENYQSAAT LHEGILYDLL      1680
     GDSGAVDHAN GADTASQHME LLRRSQARLG AEQTSSRPSA HAELFQSVAD RFGVQSEQIK      1740
     SVGEANGGEQ FGVWSKPRRF SIDVEDMEEE GQTHRNHLRE SSGAGLGGTG SQRRISVQAL      1800
//

If you have problems or comments...

PBIL Back to PBIL home page