(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE385

PENCW_10.PE385       Location/Qualifiers
FT   CDS             complement(910677..912650)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950884"
FT                   /orf_name="Pc13g03850"
FT                   /product="Pc13g03850 protein"
FT                   /protein_id="CAP91454.1"
FT                   /db_xref="UniParc:UPI0001830783"
FT                   /db_xref="UniProtKB/TrEMBL:B6H226"
FT                   /transl_table=1
FT                   /translation="MFAKAKGILDKSSSIRNEVNQGNYNGAKDIVTKGQTTKESTSQGD
FT                   KANEPVDRNSSTRDEANRGNSNGAKETSTQGQATKESTSRGAVGGAAGGAVGGVAGGAS
FT                   GSAAGMNKDLNRENVQETGRQTSQGGIGQDNTGTSSTSHTKVEQRDMGTERREASQKQQ
FT                   HSTDAKQATGSQQYDRRGSVLAGELAANYDIRKGPITTPGTFQEKNFHTPGDKPILIQR
FT                   GGTNSKTVPRGENTDNSQFAGAGAGSGNQASLSQEKSGNPVAGGDYSKESLENEIHDYE
FT                   NISPDVFSDGTTSKDLSKKAADQDVGKYHIDRKQLDKQGSQPSQKAGTSEAAAAAAAAT
FT                   AAAGGGYGMSKGADNQTSTTRKQRKRHSVSGTNATRAEDPTSTSQKSHVASTVGEQDRV
FT                   GGQGAGASSSGNRGGYTYARAVSDHGYTPKTPTNTAYSTTSGSNQTSGLRSTTTGQTNS
FT                   ALFNNGATASNKAGIASGGVLGLHQDGSYGLSGNENSGVNQGSIVGGAGTREAGAYDTS
FT                   SNNGFNTGVTHASSGANNSVGSGMTSKRIVRQLSGSGYKVTILQEKVQAVSQKCKAQLG
FT                   LSSTQISKRSPNVDVFFDAVAAERLRWMPQDGSRLDCSLRWASRLAYAVDALRESVGVF
FT                   APAANEAASLIWGFSILLLEVS"
     MFAKAKGILD KSSSIRNEVN QGNYNGAKDI VTKGQTTKES TSQGDKANEP VDRNSSTRDE        60
     ANRGNSNGAK ETSTQGQATK ESTSRGAVGG AAGGAVGGVA GGASGSAAGM NKDLNRENVQ       120
     ETGRQTSQGG IGQDNTGTSS TSHTKVEQRD MGTERREASQ KQQHSTDAKQ ATGSQQYDRR       180
     GSVLAGELAA NYDIRKGPIT TPGTFQEKNF HTPGDKPILI QRGGTNSKTV PRGENTDNSQ       240
     FAGAGAGSGN QASLSQEKSG NPVAGGDYSK ESLENEIHDY ENISPDVFSD GTTSKDLSKK       300
     AADQDVGKYH IDRKQLDKQG SQPSQKAGTS EAAAAAAAAT AAAGGGYGMS KGADNQTSTT       360
     RKQRKRHSVS GTNATRAEDP TSTSQKSHVA STVGEQDRVG GQGAGASSSG NRGGYTYARA       420
     VSDHGYTPKT PTNTAYSTTS GSNQTSGLRS TTTGQTNSAL FNNGATASNK AGIASGGVLG       480
     LHQDGSYGLS GNENSGVNQG SIVGGAGTRE AGAYDTSSNN GFNTGVTHAS SGANNSVGSG       540
     MTSKRIVRQL SGSGYKVTIL QEKVQAVSQK CKAQLGLSST QISKRSPNVD VFFDAVAAER       600
     LRWMPQDGSR LDCSLRWASR LAYAVDALRE SVGVFAPAAN EAASLIWGFS ILLLEVS          657
//

If you have problems or comments...

PBIL Back to PBIL home page