(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE387

PENCW_10.PE387       Location/Qualifiers
FT   CDS             join(complement(915608..915667),complement(915393..915512))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000202227" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672465"
FT                   /orf_name="Pc13g03870"
FT                   /product="Pc13g03870 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP91456.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR006846"
FT                   /db_xref="UniParc:UPI0001830785"
FT                   /db_xref="UniProtKB/TrEMBL:B6H228"
FT                   /transl_table=1
FT                   /translation="MGKVHGSLARAGKVKAATPKVEPQEKKKNPKGRAYKRVLYTRRFV
FT                   NVTMTGGKRKVHIE"
     MGKVHGSLAR AGKVKAATPK VEPQEKKKNP KGRAYKRVLY TRRFVNVTMT GGKRKVHIE         59
//

If you have problems or comments...

PBIL Back to PBIL home page