(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE388

PENCW_10.PE388       Location/Qualifiers
FT   CDS             complement(916205..917551)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214140" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672466"
FT                   /orf_name="Pc13g03880"
FT                   /product="Pc13g03880 protein"
FT                   /protein_id="CAP91457.1"
FT                   /db_xref="InterPro:IPR018612"
FT                   /db_xref="UniParc:UPI0001830786"
FT                   /db_xref="UniProtKB/TrEMBL:B6H229"
FT                   /transl_table=1
FT                   /translation="MPANLPYGLNLPNKSLAATKPGNALGQKRKNIFDDDSDEDQQTGD
FT                   GAIEISTIGGLEEPATNKKPSPSAGPPPKRKIQFGSGPKPTAKPLGKNSLFADDEDEDE
FT                   EREKDQQGAMNLGLNQAKSKKPTAPAQIYTNLASMHSSNVQAKAAEELDPLVYSYDEVY
FT                   DSLHAKPAKVSVETKSDTPKYMQNLLQSAEIRKRDQLRAKDRQLAREREAEGDEFEDKE
FT                   KFVTSAYKAQQAELRKAEEEEARREKEEEERRKKSGGSGMIGFYRDVLSRGEARHEEVI
FT                   KAAEETARRVKAGEIIEETEDKEDKSDAQKAEDLNAHGARVVVNDEGQVVDKRQLLSAG
FT                   LNVAPKPKAPASAAKAGVSRPTVGRPGAGAGYQGGRAAQRARQTDMVASQYEERARQEE
FT                   EAEAAKQREIAEKSRSRKTEKDVSSAKERYLARKREREEAAAKEKSKGA"
     MPANLPYGLN LPNKSLAATK PGNALGQKRK NIFDDDSDED QQTGDGAIEI STIGGLEEPA        60
     TNKKPSPSAG PPPKRKIQFG SGPKPTAKPL GKNSLFADDE DEDEEREKDQ QGAMNLGLNQ       120
     AKSKKPTAPA QIYTNLASMH SSNVQAKAAE ELDPLVYSYD EVYDSLHAKP AKVSVETKSD       180
     TPKYMQNLLQ SAEIRKRDQL RAKDRQLARE REAEGDEFED KEKFVTSAYK AQQAELRKAE       240
     EEEARREKEE EERRKKSGGS GMIGFYRDVL SRGEARHEEV IKAAEETARR VKAGEIIEET       300
     EDKEDKSDAQ KAEDLNAHGA RVVVNDEGQV VDKRQLLSAG LNVAPKPKAP ASAAKAGVSR       360
     PTVGRPGAGA GYQGGRAAQR ARQTDMVASQ YEERARQEEE AEAAKQREIA EKSRSRKTEK       420
     DVSSAKERYL ARKREREEAA AKEKSKGA                                          448
//

If you have problems or comments...

PBIL Back to PBIL home page