(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE389

PENCW_10.PE389       Location/Qualifiers
FT   CDS             join(918117..918394,918567..918933)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000214139" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950885"
FT                   /orf_name="Pc13g03890"
FT                   /product="Pc13g03890 protein"
FT                   /biological_process="ER to Golgi vesicle-mediated transport"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP91458.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006888"
FT                   /db_xref="InterPro:IPR006722"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniParc:UPI0001830787"
FT                   /db_xref="UniProtKB/TrEMBL:B6H230"
FT                   /transl_table=1
FT                   /translation="MAAASKAAIPSSSAVLGSISTLNNPSLLKMSYYFTILSPTDTPLF
FT                   NIAFGTSKGGGDGIARFRFPETAQYMNQFIIHSSLDILEEAQWTNGGMYLKHIDTYPPA
FT                   AAYITAFLTPSGARFLLLHQPPNLPSSTSSSSGLGSSSLLGTAGSTTRASSSSIAANPT
FT                   SPQTEEAVRQFMNEVYENYVKTAMSPFYKQGMEIKSPVFRTRVTAAGKKWL"
     MAAASKAAIP SSSAVLGSIS TLNNPSLLKM SYYFTILSPT DTPLFNIAFG TSKGGGDGIA        60
     RFRFPETAQY MNQFIIHSSL DILEEAQWTN GGMYLKHIDT YPPAAAYITA FLTPSGARFL       120
     LLHQPPNLPS STSSSSGLGS SSLLGTAGST TRASSSSIAA NPTSPQTEEA VRQFMNEVYE       180
     NYVKTAMSPF YKQGMEIKSP VFRTRVTAAG KKWL                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page