(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE39

PENCW_10.PE39        Location/Qualifiers
FT   CDS             join(93499..93546,93598..93995,94046..94949,94995..95606)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076570" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948694"
FT                   /orf_name="Pc13g00390"
FT                   /product="Pc13g00390 protein"
FT                   /protein_id="CAP91108.1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="UniParc:UPI0001830DCB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H184"
FT                   /transl_table=1
FT                   /translation="MLETLPCEILMLIADWLPVTTLRVLSRASSRLYAVLVPRIYRTVS
FT                   FCAASEWALNVLDVDPFFRHLGPSRAADYLQHTRHLQIRAPFHLVRFNRCAYYNIFRAA
FT                   GLPESPAPLGASDDATAHQQFLDDVKDQLQLIFTHLEPNRLSIFEWRLGTCVPVGVLDQ
FT                   EGYLSQYQQRLTRLSLVTDGTCPETSHRLEGMSRLTCLTAFEWEGLQHPSEVDLLRRCI
FT                   RQNWSCLDQLSIGFVPSAFARALCWQSLGLQRPELEDGGRGTGVTTNEDTGIANPTALS
FT                   ALSTLSLSKVTLPLDISSGHNAIFYSLRSLTLRDCPNQLHLVQLLSWSQKPLRLTHFEF
FT                   SFDYLLHEPGEGCGLSAVVRFLCSFRGLQHLHLRLSNFPSSKSHIQDTIQHHQTTLKSL
FT                   VYHERQLAPIDADGLFEDDRDVSPAWVTNLSTGVDLGQVCALALCASPSAARRCLRPTA
FT                   KHSQLQILHLRFSGLERFHRDIPREITTYLNGIRKGYSWHPRSCWSSVNRDVSNDSHNY
FT                   PPIVDEYFDRSPLEFVDSQEAVLMSSAAIAEAEDFVSFADWVFGPDGLPALQVLAFGDF
FT                   SHGDRYRSQQFLMRRVYPSSEGGGKELAGLAFDDTTRLPFCSADMSDPSIWDGAMVDGA
FT                   RFLSACPGGGLMESPYEL"
     MLETLPCEIL MLIADWLPVT TLRVLSRASS RLYAVLVPRI YRTVSFCAAS EWALNVLDVD        60
     PFFRHLGPSR AADYLQHTRH LQIRAPFHLV RFNRCAYYNI FRAAGLPESP APLGASDDAT       120
     AHQQFLDDVK DQLQLIFTHL EPNRLSIFEW RLGTCVPVGV LDQEGYLSQY QQRLTRLSLV       180
     TDGTCPETSH RLEGMSRLTC LTAFEWEGLQ HPSEVDLLRR CIRQNWSCLD QLSIGFVPSA       240
     FARALCWQSL GLQRPELEDG GRGTGVTTNE DTGIANPTAL SALSTLSLSK VTLPLDISSG       300
     HNAIFYSLRS LTLRDCPNQL HLVQLLSWSQ KPLRLTHFEF SFDYLLHEPG EGCGLSAVVR       360
     FLCSFRGLQH LHLRLSNFPS SKSHIQDTIQ HHQTTLKSLV YHERQLAPID ADGLFEDDRD       420
     VSPAWVTNLS TGVDLGQVCA LALCASPSAA RRCLRPTAKH SQLQILHLRF SGLERFHRDI       480
     PREITTYLNG IRKGYSWHPR SCWSSVNRDV SNDSHNYPPI VDEYFDRSPL EFVDSQEAVL       540
     MSSAAIAEAE DFVSFADWVF GPDGLPALQV LAFGDFSHGD RYRSQQFLMR RVYPSSEGGG       600
     KELAGLAFDD TTRLPFCSAD MSDPSIWDGA MVDGARFLSA CPGGGLMESP YEL              653
//

If you have problems or comments...

PBIL Back to PBIL home page