(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE390

PENCW_10.PE390       Location/Qualifiers
FT   CDS             join(complement(920615..920724),complement(920126..920550),
FT                   complement(919937..920068),complement(919381..919883))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000078668" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950886"
FT                   /orf_name="Pc13g03900"
FT                   /product="Pc13g03900 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP91459.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR004330"
FT                   /db_xref="UniParc:UPI0001830788"
FT                   /db_xref="UniProtKB/TrEMBL:B6H277"
FT                   /transl_table=1
FT                   /translation="MADSTDLNLDDAPSDLQDIPELAMQLVPPPEGTYPDKATLLAAVQ
FT                   DHGKEHGYNVVVKSSSTPTEKKPGRTAKVWLRCDRGGHYRPRNGLTEETRKRRRTSRLM
FT                   DCPFMLVAAGSPGIWTLTVLNAAHNHGPVIEKPRQVPHHKVRKGQLPAVPYDWPHDASF
FT                   TPYTTALVIIDMQKDFCLPEGYMGYQGYDISAAQALIPRLQRLLHAFRSGGFPVYHTRE
FT                   GHRPDLSTLSSREAYRSRNNASGLGIGSPGPMGRLLIRGELGHDTVDELYPLPGEPVID
FT                   KPGRGAFAHTDFELLLRNKGVKNLVIAGVTTDVCVSTTMREANDRGFDCVVLDDGTAAA
FT                   EPSLHLGTMQSVKMEGGIFGTVAKLEDVIHAVDNFKTVTMKKLAPQMTV"
     MADSTDLNLD DAPSDLQDIP ELAMQLVPPP EGTYPDKATL LAAVQDHGKE HGYNVVVKSS        60
     STPTEKKPGR TAKVWLRCDR GGHYRPRNGL TEETRKRRRT SRLMDCPFML VAAGSPGIWT       120
     LTVLNAAHNH GPVIEKPRQV PHHKVRKGQL PAVPYDWPHD ASFTPYTTAL VIIDMQKDFC       180
     LPEGYMGYQG YDISAAQALI PRLQRLLHAF RSGGFPVYHT REGHRPDLST LSSREAYRSR       240
     NNASGLGIGS PGPMGRLLIR GELGHDTVDE LYPLPGEPVI DKPGRGAFAH TDFELLLRNK       300
     GVKNLVIAGV TTDVCVSTTM REANDRGFDC VVLDDGTAAA EPSLHLGTMQ SVKMEGGIFG       360
     TVAKLEDVIH AVDNFKTVTM KKLAPQMTV                                         389
//

If you have problems or comments...

PBIL Back to PBIL home page