(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE391

PENCW_10.PE391       Location/Qualifiers
FT   CDS             join(921660..921896,921953..923509)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214116" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950887"
FT                   /orf_name="Pc13g03910"
FT                   /product="Pc13g03910 protein"
FT                   /protein_id="CAP91460.1"
FT                   /db_xref="InterPro:IPR006964"
FT                   /db_xref="UniParc:UPI0001830848"
FT                   /db_xref="UniProtKB/TrEMBL:B6H275"
FT                   /transl_table=1
FT                   /translation="MPAVDESTSERKHTSSSYRDELAHYKAQYELLEAELADFQSSSRE
FT                   LETEMEKDIEASEKRERQLKEKLDTMRYEVDEWKSKYKQSKTEGNSVQNNLQKEITTLR
FT                   EANRTLQLKLRDIEVANDDYERQARNTTSSLEDMESKYNIGIERQVLLEEEIRSGEQER
FT                   EQLRIDNQRLRDELSDLKIETEIIQEKLRNTEGHGMRRRKPTPLYHRSPATPQSLEIFD
FT                   RSPGTATSSPVFATPPAKSSLASSTATPPSPPISESSVNMRKSINAHSNSTPTFPRQRA
FT                   AGADPVNSRTLHARTQPRTTHSRTPSLAYSNGAYSTGNGNSSGNGRSTPSMSISSRNSL
FT                   TRMNTSRPPGLPKSGSLFQIRGLIGKMQKLEERVQSAKSRLPAPSDTSSRGSPRSGSVI
FT                   SDTPIVPSSITVRRDSRKRLSNSSLGSSARDSESTPSYPPQGRQSFGRTGESRPSSRTS
FT                   YSSRSSFSQSVHSGVPANARPESRSSRPGAKTPLGHYSTNPMTEGRRPRSSLSNHAGQL
FT                   PNIAGMSLIDEDQDITTPTTSQISQEIQRPSVTTTPTPIVKKRTISGIPAPRSFKTSIG
FT                   PGTMPPPPNRKTQVSDLGETF"
     MPAVDESTSE RKHTSSSYRD ELAHYKAQYE LLEAELADFQ SSSRELETEM EKDIEASEKR        60
     ERQLKEKLDT MRYEVDEWKS KYKQSKTEGN SVQNNLQKEI TTLREANRTL QLKLRDIEVA       120
     NDDYERQARN TTSSLEDMES KYNIGIERQV LLEEEIRSGE QEREQLRIDN QRLRDELSDL       180
     KIETEIIQEK LRNTEGHGMR RRKPTPLYHR SPATPQSLEI FDRSPGTATS SPVFATPPAK       240
     SSLASSTATP PSPPISESSV NMRKSINAHS NSTPTFPRQR AAGADPVNSR TLHARTQPRT       300
     THSRTPSLAY SNGAYSTGNG NSSGNGRSTP SMSISSRNSL TRMNTSRPPG LPKSGSLFQI       360
     RGLIGKMQKL EERVQSAKSR LPAPSDTSSR GSPRSGSVIS DTPIVPSSIT VRRDSRKRLS       420
     NSSLGSSARD SESTPSYPPQ GRQSFGRTGE SRPSSRTSYS SRSSFSQSVH SGVPANARPE       480
     SRSSRPGAKT PLGHYSTNPM TEGRRPRSSL SNHAGQLPNI AGMSLIDEDQ DITTPTTSQI       540
     SQEIQRPSVT TTPTPIVKKR TISGIPAPRS FKTSIGPGTM PPPPNRKTQV SDLGETF          597
//

If you have problems or comments...

PBIL Back to PBIL home page