(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE392

PENCW_10.PE392       Location/Qualifiers
FT   CDS             join(925189..925335,925416..925681,925752..932160)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214115" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978328"
FT                   /orf_name="Pc13g03920"
FT                   /product="Pc13g03920 protein"
FT                   /function="ATP binding"
FT                   /function="acetyl-CoA carboxylase activity"
FT                   /function="biotin binding"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /protein_id="CAP91461.1"
FT                   /db_xref="GO:0003989"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0009374"
FT                   /db_xref="InterPro:IPR000022"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013537"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR013817"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniParc:UPI0001830849"
FT                   /db_xref="UniProtKB/TrEMBL:B6H276"
FT                   /transl_table=1
FT                   /translation="MGSTMGNSSAVTKHDIPSHFIGGNALESAPPSAVKDFVAAHDGHS
FT                   VITSVLIANNGIAAVKEIRSVRKWAYETFGNERAIQFTVMATPEDLTANADYIRMADQY
FT                   VEVPGGTNNNNYANVELIVDVAERMDVHAVWAGWGHASENPRLPESLAASPKKIIFIGP
FT                   PASAMRSLGDKISSTIVAQHAGVPCIPWSGTGVDAVKLDENGIVTVEDEVYNQGCTFSP
FT                   EEGLAKAKEIGFPVMVKASEGGGGKGIRKVENEEDFPALYNAAANEIPGSPIFIMKLAG
FT                   NARHLEVQLLADQYGNNISLFGRDCSVQRRHQKIIEEAPVTIAKQPTFQAMERAAVSLG
FT                   KLVGYVSAGTVEYLYSHSDDKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGIPL
FT                   HRIRDIRLLYGVDPNTSADIDFDFSKEESFQTQRRPQPKGHTTACRITSEDPGEGFKPS
FT                   SGTMHELNFRSSSNVWGYFSVGTAGGIHSFSDSQFGHIFAYGENRSASRKHMVVALKEL
FT                   SIRGDFRTTVEYLIKLLETPAFEDNTITTGWLDQLISNKLTAERPDQIVAIICGAVTKA
FT                   HLASEAGIEEYRNGLGKGQVPSKEILKTVFPVDFIYEGERYKFTATRASLDSYHLFING
FT                   SKCSVGVRALADGGLLVLLSGRSHNVYWKEEAAATRLSVDGKTCLLEQENDPTQLRSPS
FT                   PGKLVKFTVENGEHIRSGQSYAEVEVMKMYMPLIAKEDGIVQLIKQPGATLEAGDILGI
FT                   LALDDPSRVKHAQPFTGQLPELGSPTVLGNKPSQRFFLLHSILENILRGFDNQVIMGTT
FT                   LKDLVEVLRNPDLPYGEWNAQSSALHSRIPQKLDAQLQNVVDRAKARKAEFPAKQLQKA
FT                   IVRFIEEHIGPADAELLKTTLLPLVQVINKYMDGLKSNEYNVFIGLLEQYYDVEKLFST
FT                   HNLRDEDVILKLREENKDDITGIVHTVLSHSRIGSKNNLVLAILDMYRPNQPHLENVGT
FT                   YFKPILKKLTELESRSSAKVTLKAREVLIQCAMPSLDERLSQMEHILRSSVVESRYGET
FT                   GWEHREPSLDVLKEVVDSKYTVFDVLPRFFVHADPWVTLASLEVYVRRAYRAYTLKSID
FT                   YNASTEQPFLSWDFTLGKLGQREFGVLNSTQPSAPGTPIAEVNPFKRINSIGDMSLFVS
FT                   DAASDPVRKGVIIPVQYLEDAEEILCKALEVFPVGGSNAKCPSEQGLIATLEGKRRPAP
FT                   KPVSDSELTGVCNIAIRDIEDMEDADLVAQMKQLLADNKDELLARRIRRVTFICGKQGV
FT                   YPGYFTFRGPNYEEDLSIRHSEPALAFQLELGRLSKFNIKPVFTENRNIHVYEAIGKGP
FT                   ENDKAIDKRYFVRAVVRPGRLRDDIPTAEYLISEADRLMNDILDALEIIGNNNSDLNHI
FT                   FINFSPVFNLQPVDVEQALAGFLDRFGRRLWRLRVTGAEIRILCTDPATGMPYPLRVII
FT                   SNTYGFIINVELYIERKSEKGEWIFQSIGGTAKLGSMHLRPVSTPYPTKEWLQPKRYKA
FT                   HLMGTQYVYDFPELFRQAFQNSWTKIAEKIPSLYEKRPPVGECIDYSELVLDDTDNLVE
FT                   VSREPGTNTHGMVGWIITARTPEYPRGRRFIIVANDITFQIGSFGPQEDRFFHKCTELA
FT                   RKLGIPRIYLSANSGARIGVADELIPFFSVAWNNPEKPEAGFKYLYLTPEVKKRFDASK
FT                   KKEVITELVNDDGEERHKITTVIGAKDGLGVECLKGSGLIAGATSKAYEDIFTITLVTC
FT                   RSVGIGAYLVRLGQRAIQVEGQPIILTGAPAINKLLGREVYTSNLQLGGTQIMYKNGVS
FT                   HMTANDDFAGVEKIVEWMSFVPDKKNAPIPIRPWSDTWDRDVAYFPPPKQTYDVRWLIG
FT                   GKEDVDGFLPGLFDKGSFEEALGGWARTVVVGRARLGGIPMGVIAVETRSVENVTPADP
FT                   ANPDSMEMIATEAGGVWYPNSAYKTAQALRDFNNGEQLPVMILANWRGFSGGQRDMYNE
FT                   VLKYGSYIVDALVKYEQPIFVYIPPHGELRGGSWVVVDPTINPDQMEMYADEDSRGGVL
FT                   EPEGMVNIKYRREKQLDTMARLDATYGELRRSLADTSLTNEQLSEVKAKMAAREEQLLP
FT                   VYMQIALQFADLHDRAGRMQAKDTIRKPLQWVNSRRFFYWRLRRRLSEETIVKRMVAAS
FT                   APAASGVGATGESLRTAHLRTLHAWTGLLDEELEHDDHKVATWYEENKKVVQSKVESLR
FT                   TDGVASEVAQLLIGNKEGGLRGVQQVLSMLPVEERENVLKYLGSA"
     MGSTMGNSSA VTKHDIPSHF IGGNALESAP PSAVKDFVAA HDGHSVITSV LIANNGIAAV        60
     KEIRSVRKWA YETFGNERAI QFTVMATPED LTANADYIRM ADQYVEVPGG TNNNNYANVE       120
     LIVDVAERMD VHAVWAGWGH ASENPRLPES LAASPKKIIF IGPPASAMRS LGDKISSTIV       180
     AQHAGVPCIP WSGTGVDAVK LDENGIVTVE DEVYNQGCTF SPEEGLAKAK EIGFPVMVKA       240
     SEGGGGKGIR KVENEEDFPA LYNAAANEIP GSPIFIMKLA GNARHLEVQL LADQYGNNIS       300
     LFGRDCSVQR RHQKIIEEAP VTIAKQPTFQ AMERAAVSLG KLVGYVSAGT VEYLYSHSDD       360
     KFYFLELNPR LQVEHPTTEM VSGVNLPAAQ LQIAMGIPLH RIRDIRLLYG VDPNTSADID       420
     FDFSKEESFQ TQRRPQPKGH TTACRITSED PGEGFKPSSG TMHELNFRSS SNVWGYFSVG       480
     TAGGIHSFSD SQFGHIFAYG ENRSASRKHM VVALKELSIR GDFRTTVEYL IKLLETPAFE       540
     DNTITTGWLD QLISNKLTAE RPDQIVAIIC GAVTKAHLAS EAGIEEYRNG LGKGQVPSKE       600
     ILKTVFPVDF IYEGERYKFT ATRASLDSYH LFINGSKCSV GVRALADGGL LVLLSGRSHN       660
     VYWKEEAAAT RLSVDGKTCL LEQENDPTQL RSPSPGKLVK FTVENGEHIR SGQSYAEVEV       720
     MKMYMPLIAK EDGIVQLIKQ PGATLEAGDI LGILALDDPS RVKHAQPFTG QLPELGSPTV       780
     LGNKPSQRFF LLHSILENIL RGFDNQVIMG TTLKDLVEVL RNPDLPYGEW NAQSSALHSR       840
     IPQKLDAQLQ NVVDRAKARK AEFPAKQLQK AIVRFIEEHI GPADAELLKT TLLPLVQVIN       900
     KYMDGLKSNE YNVFIGLLEQ YYDVEKLFST HNLRDEDVIL KLREENKDDI TGIVHTVLSH       960
     SRIGSKNNLV LAILDMYRPN QPHLENVGTY FKPILKKLTE LESRSSAKVT LKAREVLIQC      1020
     AMPSLDERLS QMEHILRSSV VESRYGETGW EHREPSLDVL KEVVDSKYTV FDVLPRFFVH      1080
     ADPWVTLASL EVYVRRAYRA YTLKSIDYNA STEQPFLSWD FTLGKLGQRE FGVLNSTQPS      1140
     APGTPIAEVN PFKRINSIGD MSLFVSDAAS DPVRKGVIIP VQYLEDAEEI LCKALEVFPV      1200
     GGSNAKCPSE QGLIATLEGK RRPAPKPVSD SELTGVCNIA IRDIEDMEDA DLVAQMKQLL      1260
     ADNKDELLAR RIRRVTFICG KQGVYPGYFT FRGPNYEEDL SIRHSEPALA FQLELGRLSK      1320
     FNIKPVFTEN RNIHVYEAIG KGPENDKAID KRYFVRAVVR PGRLRDDIPT AEYLISEADR      1380
     LMNDILDALE IIGNNNSDLN HIFINFSPVF NLQPVDVEQA LAGFLDRFGR RLWRLRVTGA      1440
     EIRILCTDPA TGMPYPLRVI ISNTYGFIIN VELYIERKSE KGEWIFQSIG GTAKLGSMHL      1500
     RPVSTPYPTK EWLQPKRYKA HLMGTQYVYD FPELFRQAFQ NSWTKIAEKI PSLYEKRPPV      1560
     GECIDYSELV LDDTDNLVEV SREPGTNTHG MVGWIITART PEYPRGRRFI IVANDITFQI      1620
     GSFGPQEDRF FHKCTELARK LGIPRIYLSA NSGARIGVAD ELIPFFSVAW NNPEKPEAGF      1680
     KYLYLTPEVK KRFDASKKKE VITELVNDDG EERHKITTVI GAKDGLGVEC LKGSGLIAGA      1740
     TSKAYEDIFT ITLVTCRSVG IGAYLVRLGQ RAIQVEGQPI ILTGAPAINK LLGREVYTSN      1800
     LQLGGTQIMY KNGVSHMTAN DDFAGVEKIV EWMSFVPDKK NAPIPIRPWS DTWDRDVAYF      1860
     PPPKQTYDVR WLIGGKEDVD GFLPGLFDKG SFEEALGGWA RTVVVGRARL GGIPMGVIAV      1920
     ETRSVENVTP ADPANPDSME MIATEAGGVW YPNSAYKTAQ ALRDFNNGEQ LPVMILANWR      1980
     GFSGGQRDMY NEVLKYGSYI VDALVKYEQP IFVYIPPHGE LRGGSWVVVD PTINPDQMEM      2040
     YADEDSRGGV LEPEGMVNIK YRREKQLDTM ARLDATYGEL RRSLADTSLT NEQLSEVKAK      2100
     MAAREEQLLP VYMQIALQFA DLHDRAGRMQ AKDTIRKPLQ WVNSRRFFYW RLRRRLSEET      2160
     IVKRMVAASA PAASGVGATG ESLRTAHLRT LHAWTGLLDE ELEHDDHKVA TWYEENKKVV      2220
     QSKVESLRTD GVASEVAQLL IGNKEGGLRG VQQVLSMLPV EERENVLKYL GSA             2273
//

If you have problems or comments...

PBIL Back to PBIL home page