(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE393

PENCW_10.PE393       Location/Qualifiers
FT   CDS             join(934229..934502,934551..935468,935527..936083)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210999" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950888"
FT                   /orf_name="Pc13g03930"
FT                   /product="Pc13g03930 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP91462.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000183084A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H278"
FT                   /transl_table=1
FT                   /translation="MIVVYKKIKKRNERKRLNSASNTDNAIELNPVNPRLDRKKKKTVS
FT                   PEQVAEKRRRNVYRWKIILGLFSPYCLQALDTTIIASALPFIAEDFNQIKQLNWIISVF
FT                   NLTSAAFLFFWAQLTDLFGRHIILQSAIFIMMIGSAVCTGAPTSSFSVLLLGRALQGIG
FT                   AAGVNISIRTILADRVSLAEYAVNWTVFALVSGIGFSIGPVIGGYLTQASWRWCFAINL
FT                   PIAVVAMVIVVFVLRTELQGPQSIPEFEERGTSTRSGRFLARISTIDYGGQMLFLWGFG
FT                   LLILALTWAGGTYSWNSVAVLAPMVIGAVLAGAWVVYERCMVPGALMARVLPRQKAMVP
FT                   WELLRQRDIGLLFLINFSTGIAMFAVMYFMDIYFTLVEGRSSSDAGIALLFFLPGLAAG
FT                   LYMAMFSSNVWPRQTFPALFLGSITSAVGMTVLAWGVQAGRTNIIYGMMALVGHGVGMR
FT                   MNPASMHGLAYFPAMTAQITCLASFAVPFGGLLGLTIMSTVFTNKSGVGQADAKDGVMW
FT                   AFIAMMPVMWLSVLITTFLGNVWVLKEGGHEVVNCSYLWGLIFGRDIVRERRDRGEEAG
FT                   DVELTV"
     MIVVYKKIKK RNERKRLNSA SNTDNAIELN PVNPRLDRKK KKTVSPEQVA EKRRRNVYRW        60
     KIILGLFSPY CLQALDTTII ASALPFIAED FNQIKQLNWI ISVFNLTSAA FLFFWAQLTD       120
     LFGRHIILQS AIFIMMIGSA VCTGAPTSSF SVLLLGRALQ GIGAAGVNIS IRTILADRVS       180
     LAEYAVNWTV FALVSGIGFS IGPVIGGYLT QASWRWCFAI NLPIAVVAMV IVVFVLRTEL       240
     QGPQSIPEFE ERGTSTRSGR FLARISTIDY GGQMLFLWGF GLLILALTWA GGTYSWNSVA       300
     VLAPMVIGAV LAGAWVVYER CMVPGALMAR VLPRQKAMVP WELLRQRDIG LLFLINFSTG       360
     IAMFAVMYFM DIYFTLVEGR SSSDAGIALL FFLPGLAAGL YMAMFSSNVW PRQTFPALFL       420
     GSITSAVGMT VLAWGVQAGR TNIIYGMMAL VGHGVGMRMN PASMHGLAYF PAMTAQITCL       480
     ASFAVPFGGL LGLTIMSTVF TNKSGVGQAD AKDGVMWAFI AMMPVMWLSV LITTFLGNVW       540
     VLKEGGHEVV NCSYLWGLIF GRDIVRERRD RGEEAGDVEL TV                          582
//

If you have problems or comments...

PBIL Back to PBIL home page