(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE395

PENCW_10.PE395       Location/Qualifiers
FT   CDS             join(938225..939691,939759..940127)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234886" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672467"
FT                   /orf_name="Pc13g03950"
FT                   /product="Pc13g03950 protein"
FT                   /protein_id="CAP91464.1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI000183084C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H280"
FT                   /transl_table=1
FT                   /translation="MTAISPMADPLTVLPPEIVLQILHFTPVSALASLTAASKAWHQFI
FT                   DVTHQDAIYTSEAKTAQPIGGSRDFSFLSDTHSYGKVFEGTESWKDLCKRQTLLARNWA
FT                   KPHPVSQESVLQIGNDPVWRFRADFKRRFFVSTSHAGGLNVTDMDTGLLLWQLPSVLDT
FT                   DGDGVRPHAHLEYQDGMAVFDSEGDSLEVWQTDHEGAKRGEFRRIATLNHNCQTRGFQL
FT                   SYWTLCVVSNEGQGFVYDMTQRPPKLTTHLKIEGGGIGHLDQSEDIVIYSMGAKGYFAY
FT                   NKESGAFLGTLKPSPATEKYHVLPPKAASTSTSAALAGAARIGPTPQPLPPGAFRKDCL
FT                   VPIEVAKGPLSPPDDPTHVRHGEDEWGAGMLNGDLFVGFSRAGRVFICSDFRKALRDEA
FT                   SLAANSSVLECESDGSSFDLGGWLSIRNHRIMFEIQDRIYVVALDDNNKVQNVENPARA
FT                   SYSLLTSSAPQLAVPISYMALADDAIMTTYTTLGWRDSNVPGGIPPPQGRELPRVFPTK
FT                   VIRILSLAPNLSTKSSSASGDTDKSSTADNGSLGASGPHLPSADAWRTQAGLLQLLSML
FT                   GEEVESDQSDGEDEWESMNEDDEEEEEEEEEDEEN"
     MTAISPMADP LTVLPPEIVL QILHFTPVSA LASLTAASKA WHQFIDVTHQ DAIYTSEAKT        60
     AQPIGGSRDF SFLSDTHSYG KVFEGTESWK DLCKRQTLLA RNWAKPHPVS QESVLQIGND       120
     PVWRFRADFK RRFFVSTSHA GGLNVTDMDT GLLLWQLPSV LDTDGDGVRP HAHLEYQDGM       180
     AVFDSEGDSL EVWQTDHEGA KRGEFRRIAT LNHNCQTRGF QLSYWTLCVV SNEGQGFVYD       240
     MTQRPPKLTT HLKIEGGGIG HLDQSEDIVI YSMGAKGYFA YNKESGAFLG TLKPSPATEK       300
     YHVLPPKAAS TSTSAALAGA ARIGPTPQPL PPGAFRKDCL VPIEVAKGPL SPPDDPTHVR       360
     HGEDEWGAGM LNGDLFVGFS RAGRVFICSD FRKALRDEAS LAANSSVLEC ESDGSSFDLG       420
     GWLSIRNHRI MFEIQDRIYV VALDDNNKVQ NVENPARASY SLLTSSAPQL AVPISYMALA       480
     DDAIMTTYTT LGWRDSNVPG GIPPPQGREL PRVFPTKVIR ILSLAPNLST KSSSASGDTD       540
     KSSTADNGSL GASGPHLPSA DAWRTQAGLL QLLSMLGEEV ESDQSDGEDE WESMNEDDEE       600
     EEEEEEEDEE N                                                            611
//

If you have problems or comments...

PBIL Back to PBIL home page