(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE396

PENCW_10.PE396       Location/Qualifiers
FT   CDS             join(complement(941167..941307),complement(940623..941117),
FT                   complement(940501..940569))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234703" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672468"
FT                   /orf_name="Pc13g03960"
FT                   /product="Pc13g03960 protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP91465.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000183084D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H252"
FT                   /transl_table=1
FT                   /translation="MASQLPMADLITEVNPEDLIFFQKLQESANSAVFKVAFHGRICVM
FT                   KVYHDRGPSDYDPSDLEVNLFVCESTAYQRMKANGLCEREVVPDFYGTITKIQPSLWPS
FT                   LHMFHGDNLPPNAILIEYIPNLKPISLSNFSKDYLDKFRQVLDDIHQAGVLHGDAKPRN
FT                   MMISQGKQDRVLWIDFDSAQTFPEGSLSQRQERWVQEENELVDYFIVALAQDFKEGRIN
FT                   RTASYYYEYFVE"
     MASQLPMADL ITEVNPEDLI FFQKLQESAN SAVFKVAFHG RICVMKVYHD RGPSDYDPSD        60
     LEVNLFVCES TAYQRMKANG LCEREVVPDF YGTITKIQPS LWPSLHMFHG DNLPPNAILI       120
     EYIPNLKPIS LSNFSKDYLD KFRQVLDDIH QAGVLHGDAK PRNMMISQGK QDRVLWIDFD       180
     SAQTFPEGSL SQRQERWVQE ENELVDYFIV ALAQDFKEGR INRTASYYYE YFVE             234
//

If you have problems or comments...

PBIL Back to PBIL home page