(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE397

PENCW_10.PE397       Location/Qualifiers
FT   CDS             complement(941511..942842)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950889"
FT                   /orf_name="Pc13g03970"
FT                   /product="Pc13g03970 protein"
FT                   /protein_id="CAP91466.1"
FT                   /db_xref="InterPro:IPR022137"
FT                   /db_xref="UniParc:UPI000183084E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H253"
FT                   /transl_table=1
FT                   /translation="MELDSFSSFPTSTTTTTTAMSSHQREIPEDSVASYDTALSIDACL
FT                   ASATEEMLEVTEDLAKDEDILRQTLSVRSTISTSRSFAERMQRAEFFQNTPLVVIGRGT
FT                   CGTIFEIPGTESAYKKGSDKAALWNDANLTNIACRAVTETKTCLQEIFPNVSIPRVPVV
FT                   TGWISENDLENWWRENLRRFPKDTRKTGYLFQVQRILPLPKPCREALIHLYFPKTMRES
FT                   AHEDPDNKACLVRPYLGQRRGERELSNPALSLQNFPLYLDQIEELELEVEAIQFAEEMA
FT                   IGLATIHWKACLDGMDMEFVLGSAATNGELPTVVENFKTVAPFDIPAGDVERRQVHLWM
FT                   LDFDKAEQLCLKKSWKSCCDKMVTAVTANDPYFPNPAAMGTLEQKLWDTFERAYLLAAS
FT                   DLLLTQKALPKEASKYPALFLKAWKKRATELAEDTEGDFVEFGE"
     MELDSFSSFP TSTTTTTTAM SSHQREIPED SVASYDTALS IDACLASATE EMLEVTEDLA        60
     KDEDILRQTL SVRSTISTSR SFAERMQRAE FFQNTPLVVI GRGTCGTIFE IPGTESAYKK       120
     GSDKAALWND ANLTNIACRA VTETKTCLQE IFPNVSIPRV PVVTGWISEN DLENWWRENL       180
     RRFPKDTRKT GYLFQVQRIL PLPKPCREAL IHLYFPKTMR ESAHEDPDNK ACLVRPYLGQ       240
     RRGERELSNP ALSLQNFPLY LDQIEELELE VEAIQFAEEM AIGLATIHWK ACLDGMDMEF       300
     VLGSAATNGE LPTVVENFKT VAPFDIPAGD VERRQVHLWM LDFDKAEQLC LKKSWKSCCD       360
     KMVTAVTAND PYFPNPAAMG TLEQKLWDTF ERAYLLAASD LLLTQKALPK EASKYPALFL       420
     KAWKKRATEL AEDTEGDFVE FGE                                               443
//

If you have problems or comments...

PBIL Back to PBIL home page