(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE398

PENCW_10.PE398       Location/Qualifiers
FT   CDS             join(complement(944080..947413),complement(943392..943879))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214094" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950890"
FT                   /orf_name="Pc13g03980"
FT                   /product="Pc13g03980 protein"
FT                   /protein_id="CAP91467.1"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI000183084F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H254"
FT                   /transl_table=1
FT                   /translation="MSVLRHGGGGGFLQRRLTKLYTDTKTSCESVTTASKALDDPELVA
FT                   LHGSFQKQRDRLLAWGLDWSDASAAQPNDIDESLTAAGFSDVVESVMSSIQELLNDAEQ
FT                   VQHVDAPMLPSKERKVDIPSKDTLASRPVKTQWTEEDITRSNKILNELTGCIDTLYDLS
FT                   RSRRTMASSMSSSRNSARRPRPNLTSPYDSSHGSFSDSKEKVQSPKQMFDTFTYSPTTT
FT                   HRDSPNPFLPLNHLLIDRSALQLYGAAHDNSPPPYEPVAASSNSRAIGRLKSSASHLLA
FT                   STKESHVSVLVEFMPILAESKMDNKSARLEKLQQSLDQLLQNARISHLGLMRFLGYCID
FT                   NSNSRYAFLYQMPVDYFPFLQNPSDLLKELKPKPLVALLPSAEEYRENRVPNLDTRFRL
FT                   AYDLLMSALHLRSQNAIHGNINSSNVIFFPGRSDASDDESGLVPDLRRPYLTSPARFSG
FT                   DGPTPEPLSSAMYRHPEDKRCVEDDGAWAYDLYSLGLILLEIGLWAPVGRLWKMKYDRS
FT                   WFKHRVEDLYVKKLGPKCGGAYLQAVQLCLDAPNFHLSTQPMTDLGLRVPQIYHYPVLD
FT                   LSDPDGTFSFSMNFMYTICKILWSCCRIDIFSAPSAEELDDCLPLALVPTPEPVTIEDK
FT                   VRAYKSSKREMSNYDKKLPTIPADAWSVANEDKLIEKPQKKRTVKRLPHMEIPDEHLQE
FT                   WNFQIMPRVSRLLQKILKESSESCGVNLIMTGESPESAKTTICVTCASVKKVRMALKKH
FT                   FALGRDDWDLIVLRGDIERSKVPRNRRRRPAKARPNVSNDTPFRQRELNPCHQQRPLCG
FT                   ASIGTFQNEEHLPPVSYGGAVIVDGLPYGLTVHHMLEAPSEDEGQDSGPAEFNQDAPSR
FT                   SAGNWPRDTSNIPHPGFRYDYPEDDSSDMNFDFEVSDMEDGDDPSQGLESGYDEFWLSD
FT                   EDSSDDDSIGPDDDDDDTASIGDTAGIEPGEEPRLLVTQPAIDDVHEDFFPSPEDRDDE
FT                   HLASHSLGYVHASSGVRRWTRKGLKHEIDWALIKVDEARMDPRNIILDTTRSSIARPGR
FT                   PIPPQPIFLNQVARMEELGGLQVHCCGRTSGLQTGQISKAMTLVKLQGRHSFSTSFCVN
FT                   GNFGAPGDSGAWVFDRPTGRVCGHVLAWSAKSNTTYISPMEVTFDDIARTLRASVVSLP
FT                   GDPSRSMGYVDPNSPQAAQYRYQAQRLPGDFGRLTFGAGGSPGPPVPPYPHHYPHPQAH
FT                   HPAYGRPPPPPPPPPGSREAHGPVYSGPVPPIPPSLLAGPRNIERQLA"
     MSVLRHGGGG GFLQRRLTKL YTDTKTSCES VTTASKALDD PELVALHGSF QKQRDRLLAW        60
     GLDWSDASAA QPNDIDESLT AAGFSDVVES VMSSIQELLN DAEQVQHVDA PMLPSKERKV       120
     DIPSKDTLAS RPVKTQWTEE DITRSNKILN ELTGCIDTLY DLSRSRRTMA SSMSSSRNSA       180
     RRPRPNLTSP YDSSHGSFSD SKEKVQSPKQ MFDTFTYSPT TTHRDSPNPF LPLNHLLIDR       240
     SALQLYGAAH DNSPPPYEPV AASSNSRAIG RLKSSASHLL ASTKESHVSV LVEFMPILAE       300
     SKMDNKSARL EKLQQSLDQL LQNARISHLG LMRFLGYCID NSNSRYAFLY QMPVDYFPFL       360
     QNPSDLLKEL KPKPLVALLP SAEEYRENRV PNLDTRFRLA YDLLMSALHL RSQNAIHGNI       420
     NSSNVIFFPG RSDASDDESG LVPDLRRPYL TSPARFSGDG PTPEPLSSAM YRHPEDKRCV       480
     EDDGAWAYDL YSLGLILLEI GLWAPVGRLW KMKYDRSWFK HRVEDLYVKK LGPKCGGAYL       540
     QAVQLCLDAP NFHLSTQPMT DLGLRVPQIY HYPVLDLSDP DGTFSFSMNF MYTICKILWS       600
     CCRIDIFSAP SAEELDDCLP LALVPTPEPV TIEDKVRAYK SSKREMSNYD KKLPTIPADA       660
     WSVANEDKLI EKPQKKRTVK RLPHMEIPDE HLQEWNFQIM PRVSRLLQKI LKESSESCGV       720
     NLIMTGESPE SAKTTICVTC ASVKKVRMAL KKHFALGRDD WDLIVLRGDI ERSKVPRNRR       780
     RRPAKARPNV SNDTPFRQRE LNPCHQQRPL CGASIGTFQN EEHLPPVSYG GAVIVDGLPY       840
     GLTVHHMLEA PSEDEGQDSG PAEFNQDAPS RSAGNWPRDT SNIPHPGFRY DYPEDDSSDM       900
     NFDFEVSDME DGDDPSQGLE SGYDEFWLSD EDSSDDDSIG PDDDDDDTAS IGDTAGIEPG       960
     EEPRLLVTQP AIDDVHEDFF PSPEDRDDEH LASHSLGYVH ASSGVRRWTR KGLKHEIDWA      1020
     LIKVDEARMD PRNIILDTTR SSIARPGRPI PPQPIFLNQV ARMEELGGLQ VHCCGRTSGL      1080
     QTGQISKAMT LVKLQGRHSF STSFCVNGNF GAPGDSGAWV FDRPTGRVCG HVLAWSAKSN      1140
     TTYISPMEVT FDDIARTLRA SVVSLPGDPS RSMGYVDPNS PQAAQYRYQA QRLPGDFGRL      1200
     TFGAGGSPGP PVPPYPHHYP HPQAHHPAYG RPPPPPPPPP GSREAHGPVY SGPVPPIPPS      1260
     LLAGPRNIER QLA                                                         1273
//

If you have problems or comments...

PBIL Back to PBIL home page