(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE4

PENCW_10.PE4         Location/Qualifiers
FT   CDS             12098..13576
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977560"
FT                   /orf_name="Pc13g00040"
FT                   /product="Putative uncharacterized protein Pc13g00040 "
FT                   /protein_id="CAP91073.1"
FT                   /db_xref="UniParc:UPI0001830CF7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5H1"
FT                   /transl_table=1
FT                   /translation="MAESGSGVSQPKAAAADAQASYIQPDSSKGTGAHITNQSQSIQSQ
FT                   SKPPYNTQEEQPSPDGTRETVPGEPNDQPMGDAGSEREPSGSPVAGPRSGHMAENATES
FT                   GSPASVGANDPSDSSDEVLTDLKKLSIGSDRDGEPDAWSRLGRSNVLLVRYGPYKAAKY
FT                   RVQPGNGYNTQGLQKVSKKKTRISCVMYEGEDGEEHYRYSRDNIVGFVGVAFYERKADP
FT                   DKDYKIAPPAFVKVKWQGIDAAHQGLLTRGNSWITKQDLVRLTDLATAEQKISEAWDKQ
FT                   EERHIQWQGQIGRDSPDRSPTPCPLDLFKAQKQERIKRELTIKRELTREPSIPSAQGME
FT                   VDPEGWRLGSRQPAANNTQRLDSVSVKQELDSEDDEDNDLFVDDSSPNARNASDQNTSD
FT                   QNTSGQNTSGQDGNGPNNNGLNNDIRSGSGQNRPPPKLSKFYKRWLRRARIPETDFNNL
FT                   DDAYIGRFEAAAYAYMDELRKQGYVVEDDLGMDI"
     MAESGSGVSQ PKAAAADAQA SYIQPDSSKG TGAHITNQSQ SIQSQSKPPY NTQEEQPSPD        60
     GTRETVPGEP NDQPMGDAGS EREPSGSPVA GPRSGHMAEN ATESGSPASV GANDPSDSSD       120
     EVLTDLKKLS IGSDRDGEPD AWSRLGRSNV LLVRYGPYKA AKYRVQPGNG YNTQGLQKVS       180
     KKKTRISCVM YEGEDGEEHY RYSRDNIVGF VGVAFYERKA DPDKDYKIAP PAFVKVKWQG       240
     IDAAHQGLLT RGNSWITKQD LVRLTDLATA EQKISEAWDK QEERHIQWQG QIGRDSPDRS       300
     PTPCPLDLFK AQKQERIKRE LTIKRELTRE PSIPSAQGME VDPEGWRLGS RQPAANNTQR       360
     LDSVSVKQEL DSEDDEDNDL FVDDSSPNAR NASDQNTSDQ NTSGQNTSGQ DGNGPNNNGL       420
     NNDIRSGSGQ NRPPPKLSKF YKRWLRRARI PETDFNNLDD AYIGRFEAAA YAYMDELRKQ       480
     GYVVEDDLGM DI                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page