(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE40

PENCW_10.PE40        Location/Qualifiers
FT   CDS             join(complement(101204..101767),complement(100869..101129),
FT                   complement(100436..100619),complement(100088..100213),
FT                   complement(99639..100003))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948695"
FT                   /orf_name="Pc13g00400"
FT                   /product="Pc13g00400 protein"
FT                   /protein_id="CAP91109.1"
FT                   /db_xref="UniParc:UPI0001830DCC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H168"
FT                   /transl_table=1
FT                   /translation="MPPTGSKWYRWIADTSLPNLYAISAAIILAICLIYWLARDVSLWM
FT                   WTRHHVVFLFPFRSRMLGSWRRLAFVHLPKCLHWLDIPNYREALILAVMLAANIVGLRL
FT                   RAHSWAEAQKRAGSLAVINLVPLCTGISFGLPADLLHVDRQMLAWFHRWIGRICVLHSL
FT                   FHCSLLVAAARTMNLVTPRHIFPIAALVLVIPVTCAAVQRRYLQFAMKCHYLLAATAIG
FT                   TLIYHLVERRSLYRWYLVGAICLWFFISAVVCIMAAWNQKPWGSSQKEVVMNSILGPYG
FT                   HPLDFYRFGTILFVVEDIGFFRALSYIEMLVEASCRREVMVRKLEVLWKRQVGKDGPQN
FT                   NISYEYAERICYFYGSIKIEEEVERYLNNHQCGAVAVAVCAGPSIREAVTKTIRLRTGR
FT                   NLQLMVFDPDMCPAPDGLVDSLSSDETPAGSQDPPHQLLGVGEDRHTHQVRRFLADSSK
FT                   LQYPSPKEIYTEAGNVEMNNHSKWVESRLAQGRRKPTTTKP"
     MPPTGSKWYR WIADTSLPNL YAISAAIILA ICLIYWLARD VSLWMWTRHH VVFLFPFRSR        60
     MLGSWRRLAF VHLPKCLHWL DIPNYREALI LAVMLAANIV GLRLRAHSWA EAQKRAGSLA       120
     VINLVPLCTG ISFGLPADLL HVDRQMLAWF HRWIGRICVL HSLFHCSLLV AAARTMNLVT       180
     PRHIFPIAAL VLVIPVTCAA VQRRYLQFAM KCHYLLAATA IGTLIYHLVE RRSLYRWYLV       240
     GAICLWFFIS AVVCIMAAWN QKPWGSSQKE VVMNSILGPY GHPLDFYRFG TILFVVEDIG       300
     FFRALSYIEM LVEASCRREV MVRKLEVLWK RQVGKDGPQN NISYEYAERI CYFYGSIKIE       360
     EEVERYLNNH QCGAVAVAVC AGPSIREAVT KTIRLRTGRN LQLMVFDPDM CPAPDGLVDS       420
     LSSDETPAGS QDPPHQLLGV GEDRHTHQVR RFLADSSKLQ YPSPKEIYTE AGNVEMNNHS       480
     KWVESRLAQG RRKPTTTKP                                                    499
//

If you have problems or comments...

PBIL Back to PBIL home page