(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE400

PENCW_10.PE400       Location/Qualifiers
FT   CDS             join(953521..953639,953703..954440,954498..955914)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214072" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825160"
FT                   /orf_name="Pc13g04000"
FT                   /product="Pc13g04000 protein"
FT                   /protein_id="CAP91469.1"
FT                   /db_xref="UniParc:UPI0001830912"
FT                   /db_xref="UniProtKB/TrEMBL:B6H256"
FT                   /transl_table=1
FT                   /translation="MVVKENGQVADATPKPNGQTRLEKPRKKGFVRWTVGLVVRLCIWY
FT                   TLVTTFLRCPSRLTDLTETSPRVCKPYLIARSHVEPYVTPYYDIYAAPYVDQARPYVDQ
FT                   ARPYVEVFNQQVYTPASKVAKSGYEKYGAPALKQAQVYGIEQWQRQVAPRLQTAQDKAH
FT                   KLYLTEIDPYVQQSVAVVSPYYQLVNTAVLNVYQGHLVPLYARSKPFIGIAYSTGQDVL
FT                   TTHVLPWAQYSWSSAVYFANSSLWPHITGLYSEQVEPQLVKIGQRLASYREGKRLRAVV
FT                   EDVDSSTVQPVTSSATKSQEQIHTTTTVTSTSTPQASPQPTLTPTEQAQQAREKIDSDL
FT                   ERWQEKFALAADKGIEDLEDRIEEIVSALVASSANSHGRSLHTALQSVSAEQLSSIKQR
FT                   INELAASMPEEDAPEIEEATSDLLIGEIRTSAISVRDRAHALREWSISFEDELVRRVNA
FT                   AVNSTLDVLDSIRDLGLQEIGMRWAWMDGVTYKDWAKYHALKAQLEEWRNDIRNVGMNH
FT                   KSVSDARAVASEILDQGMHEAEQAARELVRLKDVGIWKIAAREVSDDFETRTEAPPARP
FT                   KPQEQTKESDEEEAKVDSDDDESSEEVAASMSDDAYEETLSTNEPSAAADAEADFDGAN
FT                   ESVMDDDIVEEEQPPARPAFGVSAADANSHQAPILDGEGQDVMDSPASKSGDTYAVASN
FT                   AVSEAIYGASSTPGVGERAASLASDQYSLAWSAASTVINGTPLSSGEKAYSDASEKYSD
FT                   AVAA"
     MVVKENGQVA DATPKPNGQT RLEKPRKKGF VRWTVGLVVR LCIWYTLVTT FLRCPSRLTD        60
     LTETSPRVCK PYLIARSHVE PYVTPYYDIY AAPYVDQARP YVDQARPYVE VFNQQVYTPA       120
     SKVAKSGYEK YGAPALKQAQ VYGIEQWQRQ VAPRLQTAQD KAHKLYLTEI DPYVQQSVAV       180
     VSPYYQLVNT AVLNVYQGHL VPLYARSKPF IGIAYSTGQD VLTTHVLPWA QYSWSSAVYF       240
     ANSSLWPHIT GLYSEQVEPQ LVKIGQRLAS YREGKRLRAV VEDVDSSTVQ PVTSSATKSQ       300
     EQIHTTTTVT STSTPQASPQ PTLTPTEQAQ QAREKIDSDL ERWQEKFALA ADKGIEDLED       360
     RIEEIVSALV ASSANSHGRS LHTALQSVSA EQLSSIKQRI NELAASMPEE DAPEIEEATS       420
     DLLIGEIRTS AISVRDRAHA LREWSISFED ELVRRVNAAV NSTLDVLDSI RDLGLQEIGM       480
     RWAWMDGVTY KDWAKYHALK AQLEEWRNDI RNVGMNHKSV SDARAVASEI LDQGMHEAEQ       540
     AARELVRLKD VGIWKIAARE VSDDFETRTE APPARPKPQE QTKESDEEEA KVDSDDDESS       600
     EEVAASMSDD AYEETLSTNE PSAAADAEAD FDGANESVMD DDIVEEEQPP ARPAFGVSAA       660
     DANSHQAPIL DGEGQDVMDS PASKSGDTYA VASNAVSEAI YGASSTPGVG ERAASLASDQ       720
     YSLAWSAAST VINGTPLSSG EKAYSDASEK YSDAVAA                                757
//

If you have problems or comments...

PBIL Back to PBIL home page