(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE401

PENCW_10.PE401       Location/Qualifiers
FT   CDS             956123..957532
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825161"
FT                   /orf_name="Pc13g04010"
FT                   /product="Pc13g04010 protein"
FT                   /protein_id="CAP91470.1"
FT                   /db_xref="UniParc:UPI0001830913"
FT                   /db_xref="UniProtKB/TrEMBL:B6H257"
FT                   /transl_table=1
FT                   /translation="MAESSAPAHSQLLSSIESAYSGSVKYATDELESKLRAVRATPTPS
FT                   NAGPLAQISSIASSRLNQGLSLASEQLSQVQPPATTGSLPHGHLDPFVLDAQRRYYEAV
FT                   GLAHDHYSAFVSTASGVVYGSPIPTPTGGSKGIIEEARSQYEQASSLASASLAAVVASA
FT                   SSAMSSADGGKPQSIIEDASSRYNAALSAASSSLSTASISASSAIYGTSTGPVESISSQ
FT                   ASENWESLISKASEQIYGAPTPYLQQVVNNGRAQYEAVQEIVSELIVGKQPSYTESVLS
FT                   KLRAAYETPYPAAAASASSYINEAYGSASSAAASVVSEAPSVEDIIQGANDQLHAAVET
FT                   ASVGIYGTPKGSYQKATDAAADAYSTASAQVSYAVYGKESSYIDVAKDAIENIQSTASA
FT                   AIYGEEPNAMESAAVRLAEAKENAMSQLADLASRLPGSNAASEAVETAASHVKDTTSSI
FT                   KSVAASVKDEL"
     MAESSAPAHS QLLSSIESAY SGSVKYATDE LESKLRAVRA TPTPSNAGPL AQISSIASSR        60
     LNQGLSLASE QLSQVQPPAT TGSLPHGHLD PFVLDAQRRY YEAVGLAHDH YSAFVSTASG       120
     VVYGSPIPTP TGGSKGIIEE ARSQYEQASS LASASLAAVV ASASSAMSSA DGGKPQSIIE       180
     DASSRYNAAL SAASSSLSTA SISASSAIYG TSTGPVESIS SQASENWESL ISKASEQIYG       240
     APTPYLQQVV NNGRAQYEAV QEIVSELIVG KQPSYTESVL SKLRAAYETP YPAAAASASS       300
     YINEAYGSAS SAAASVVSEA PSVEDIIQGA NDQLHAAVET ASVGIYGTPK GSYQKATDAA       360
     ADAYSTASAQ VSYAVYGKES SYIDVAKDAI ENIQSTASAA IYGEEPNAME SAAVRLAEAK       420
     ENAMSQLADL ASRLPGSNAA SEAVETAASH VKDTTSSIKS VAASVKDEL                   469
//

If you have problems or comments...

PBIL Back to PBIL home page