(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE402

PENCW_10.PE402       Location/Qualifiers
FT   CDS             join(complement(958866..958874),complement(958269..958775))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000214061" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672469"
FT                   /orf_name="Pc13g04020"
FT                   /product="Pc13g04020 protein"
FT                   /protein_id="CAP91471.1"
FT                   /db_xref="InterPro:IPR008506"
FT                   /db_xref="UniParc:UPI0001830914"
FT                   /db_xref="UniProtKB/TrEMBL:B6H258"
FT                   /transl_table=1
FT                   /translation="MAQKAAKSLATRNGAVLSRTHLISAALHLLFLLLHFVFQRPRSLK
FT                   PYLFLAVPTLAIEYYLDRMGRPRYNEDGSLRSAGEDLNATGLTEYMWDVLYWTQGCIVA
FT                   VCLFNDRAWWLWVVIPLYSVYAAYTTIMGVKKGFAGMGGGDAGQEGDVPKSKTQLKKEK
FT                   RGPTMKYR"
     MAQKAAKSLA TRNGAVLSRT HLISAALHLL FLLLHFVFQR PRSLKPYLFL AVPTLAIEYY        60
     LDRMGRPRYN EDGSLRSAGE DLNATGLTEY MWDVLYWTQG CIVAVCLFND RAWWLWVVIP       120
     LYSVYAAYTT IMGVKKGFAG MGGGDAGQEG DVPKSKTQLK KEKRGPTMKY R                171
//

If you have problems or comments...

PBIL Back to PBIL home page