(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE406

PENCW_10.PE406       Location/Qualifiers
FT   CDS             join(966426..966658,966713..967283)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000039949" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950893"
FT                   /orf_name="Pc13g04060"
FT                   /product="Pc13g04060 protein"
FT                   /function="transferase activity"
FT                   /biological_process="glutamine catabolic process "
FT                   /biological_process="pyridoxal phosphate biosynthetic
FT                   process"
FT                   /protein_id="CAP91475.1"
FT                   /db_xref="GO:0006543"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0042823"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="UniParc:UPI0001830918"
FT                   /db_xref="UniProtKB/TrEMBL:B6H268"
FT                   /transl_table=1
FT                   /translation="MAITVGVLALQGAFFEHVQLLKKAAEQAQPSEWHFIEVRTPQELA
FT                   TCDGLVLPGGESTTMSLVAARSNLLEPLREFVKVDRKPTWGTCAGLILLAESANKTKKG
FT                   GQELIGGLDVRVNRNHFGRQTESFQGPLDLPFLGQDAPPFPAVFIRAPIVEKILPHHEG
FT                   IQAEEIQQEDVVVAPSREARDSVAQAATAEHVEVLATLVGPAAQHATEGRDVNPDQEVG
FT                   DIVAVRQGNVFGTSFHPELTGDARIHAWWLREVQAAVLRREKLKQ"
     MAITVGVLAL QGAFFEHVQL LKKAAEQAQP SEWHFIEVRT PQELATCDGL VLPGGESTTM        60
     SLVAARSNLL EPLREFVKVD RKPTWGTCAG LILLAESANK TKKGGQELIG GLDVRVNRNH       120
     FGRQTESFQG PLDLPFLGQD APPFPAVFIR APIVEKILPH HEGIQAEEIQ QEDVVVAPSR       180
     EARDSVAQAA TAEHVEVLAT LVGPAAQHAT EGRDVNPDQE VGDIVAVRQG NVFGTSFHPE       240
     LTGDARIHAW WLREVQAAVL RREKLKQ                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page