(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE407

PENCW_10.PE407       Location/Qualifiers
FT   CDS             join(complement(968162..968227),complement(967968..968071),
FT                   complement(967866..967910),complement(967622..967813),
FT                   complement(967435..967564))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217589" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825162"
FT                   /orf_name="Pc13g04070"
FT                   /product="Pc13g04070 protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAP91476.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0001830919"
FT                   /db_xref="UniProtKB/TrEMBL:B6H259"
FT                   /transl_table=1
FT                   /translation="MSLLARNTVDRLDRPSAYYVSKNKRRRFNDRDEDEPQQEEKPDEK
FT                   LKNATTLYVGNLSFYTTEEQIHELFAKCGEIKRLVMGLDRFNKTPCGFCFVEYYTHQDA
FT                   LDCLKYIGGTKLDERIIRTDLDPGFEEGRQFGRGKSGGQVRDEYREEYDPGRGGYGRAY
FT                   DEQRQREEDEYGAGR"
     MSLLARNTVD RLDRPSAYYV SKNKRRRFND RDEDEPQQEE KPDEKLKNAT TLYVGNLSFY        60
     TTEEQIHELF AKCGEIKRLV MGLDRFNKTP CGFCFVEYYT HQDALDCLKY IGGTKLDERI       120
     IRTDLDPGFE EGRQFGRGKS GGQVRDEYRE EYDPGRGGYG RAYDEQRQRE EDEYGAGR         178
//

If you have problems or comments...

PBIL Back to PBIL home page