(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE408

PENCW_10.PE408       Location/Qualifiers
FT   CDS             join(968476..968784,968856..970967,971024..971187,
FT                   971242..971299)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214017" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129528"
FT                   /orf_name="Pc13g04080"
FT                   /product="Pc13g04080 protein"
FT                   /protein_id="CAP91477.1"
FT                   /db_xref="UniParc:UPI000183091A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H260"
FT                   /transl_table=1
FT                   /translation="MVKVNSYAPAWLCRPSPGAKFLSSSSAQNPAEDLQTGRKPVSSGA
FT                   TRTIAKRGNEVFAVVDNEIRWSNLARLKDQWQQEIKQKKGSVSETEEQTDNTQISPYRV
FT                   LAVPVYGLIKQIIPSPNGAFLAIVTEHTVHISVLPDSSHLSSSDSDSIRLKTYQLGPTT
FT                   HVIPEAPVVSALWHPLGLHTNLGGCIVTITADAAVRVWELDRNNHWSFDQPTLAIDLKK
FT                   LVDGTSSDQDFTPSGFGKSKGFSADVIDMEVASACFAGSGNEKEDAWAPMTLWVAMRPG
FT                   DLYALCPLLPSKWQAPSTTIPSLSAAIIPKLGALEQEPEESEEELIACRQQYDWLSELD
FT                   EQEPLDTPSGSETIQGADVFTRPANPSAIPRLQGPFRFDSGDELDDLDLCDLLVIAASL
FT                   NVEDLMMGEEEELAVETGDQEKLSATVLSLTSGNGRVHVCLELDGVEGQWLPKAKKNAF
FT                   RTPISEPTELVLVESLDTIKDGEETTTWPTFTKDVHSRYSFFVTTATNVVFLSLSGWVQ
FT                   RLEAELQTEDTAGSAFRLRVLCDGDVTNRQRILQVSDADTTAQNEHLAASLVFHDFDLG
FT                   YLLLTYHPSNPYAVVMDAPEDSLSVALDKSLYEPRAPAPGLPVLPPSRAPYQVPAIFYA
FT                   NSPLDSFVEKHVPHRQRHTLKEQVRLSPATLDLVATAHRVLSAHTNALERAASDLFRRC
FT                   ERLQGEMQDQLKQLADVAERVKGVTSEIGEDGHRKEGVRNGEALDKRLQAAQDKQSELN
FT                   RRYEALRTKVLNSGGRPLSEREKAWITEVKTLSASLQQVEEQEEEQPLVSRLETVKRLA
FT                   RDLMAQTKSVAGKMPSPELGTPSSPGGQPKVPQRLQRAKVADAMRMVERESAVIEAITS
FT                   RLERLNTSL"
     MVKVNSYAPA WLCRPSPGAK FLSSSSAQNP AEDLQTGRKP VSSGATRTIA KRGNEVFAVV        60
     DNEIRWSNLA RLKDQWQQEI KQKKGSVSET EEQTDNTQIS PYRVLAVPVY GLIKQIIPSP       120
     NGAFLAIVTE HTVHISVLPD SSHLSSSDSD SIRLKTYQLG PTTHVIPEAP VVSALWHPLG       180
     LHTNLGGCIV TITADAAVRV WELDRNNHWS FDQPTLAIDL KKLVDGTSSD QDFTPSGFGK       240
     SKGFSADVID MEVASACFAG SGNEKEDAWA PMTLWVAMRP GDLYALCPLL PSKWQAPSTT       300
     IPSLSAAIIP KLGALEQEPE ESEEELIACR QQYDWLSELD EQEPLDTPSG SETIQGADVF       360
     TRPANPSAIP RLQGPFRFDS GDELDDLDLC DLLVIAASLN VEDLMMGEEE ELAVETGDQE       420
     KLSATVLSLT SGNGRVHVCL ELDGVEGQWL PKAKKNAFRT PISEPTELVL VESLDTIKDG       480
     EETTTWPTFT KDVHSRYSFF VTTATNVVFL SLSGWVQRLE AELQTEDTAG SAFRLRVLCD       540
     GDVTNRQRIL QVSDADTTAQ NEHLAASLVF HDFDLGYLLL TYHPSNPYAV VMDAPEDSLS       600
     VALDKSLYEP RAPAPGLPVL PPSRAPYQVP AIFYANSPLD SFVEKHVPHR QRHTLKEQVR       660
     LSPATLDLVA TAHRVLSAHT NALERAASDL FRRCERLQGE MQDQLKQLAD VAERVKGVTS       720
     EIGEDGHRKE GVRNGEALDK RLQAAQDKQS ELNRRYEALR TKVLNSGGRP LSEREKAWIT       780
     EVKTLSASLQ QVEEQEEEQP LVSRLETVKR LARDLMAQTK SVAGKMPSPE LGTPSSPGGQ       840
     PKVPQRLQRA KVADAMRMVE RESAVIEAIT SRLERLNTSL                             880
//

If you have problems or comments...

PBIL Back to PBIL home page