(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE409

PENCW_10.PE409       Location/Qualifiers
FT   CDS             join(complement(971696..972393),complement(971500..971557))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950894"
FT                   /orf_name="Pc13g04090"
FT                   /product="Putative uncharacterized protein Pc13g04090 "
FT                   /protein_id="CAP91478.1"
FT                   /db_xref="UniParc:UPI000183091B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H261"
FT                   /transl_table=1
FT                   /translation="MCIYWTCKYTLCGCIWDMDPSKCQDKRLCWGPRMITLESHTATCA
FT                   DCWARGDKRVYEPPTCEKTDRDEEDPEMATLDFEPNAAESDNISDDDEEYFSAEESLSP
FT                   SPCSRPATPQLYYEVHPPWCPVSEDNDFDLTRACDPVDLTSVGRDYRARRHKTTTLEYL
FT                   SDSEDSFVSCEEYVDEETPDEESFSSGNEEEDLYYSIIGPPGRPKGLIKSLEDRSLLFY
FT                   GSAQEYYPTGEWEQDEAPKWCGFMKRAAI"
     MCIYWTCKYT LCGCIWDMDP SKCQDKRLCW GPRMITLESH TATCADCWAR GDKRVYEPPT        60
     CEKTDRDEED PEMATLDFEP NAAESDNISD DDEEYFSAEE SLSPSPCSRP ATPQLYYEVH       120
     PPWCPVSEDN DFDLTRACDP VDLTSVGRDY RARRHKTTTL EYLSDSEDSF VSCEEYVDEE       180
     TPDEESFSSG NEEEDLYYSI IGPPGRPKGL IKSLEDRSLL FYGSAQEYYP TGEWEQDEAP       240
     KWCGFMKRAA I                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page