(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE410

PENCW_10.PE410       Location/Qualifiers
FT   CDS             join(complement(975283..975285),complement(974833..975233),
FT                   complement(974659..974779))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000275331" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950895"
FT                   /orf_name="Pc13g04100"
FT                   /product="Pc13g04100 protein"
FT                   /function="isomerase activity"
FT                   /protein_id="CAP91479.1"
FT                   /db_xref="GO:0016853"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="UniParc:UPI000183091C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H262"
FT                   /transl_table=1
FT                   /translation="MADTGLPAGWEVRHSNSKNLPYYFNPSTKESRWEPPAETDTDKLK
FT                   VYMAQNHTPAARPDPSGEGEGKIRCSHLLVKHRDSRRPSSWREADITRTKEEAIEILKG
FT                   HEQRIQSGETTLGDLAVAESDCSSARKKGDLGFFGRGEMQKEFEDAAFGLQPGQVSSVI
FT                   ETASGVHLIER"
     MADTGLPAGW EVRHSNSKNL PYYFNPSTKE SRWEPPAETD TDKLKVYMAQ NHTPAARPDP        60
     SGEGEGKIRC SHLLVKHRDS RRPSSWREAD ITRTKEEAIE ILKGHEQRIQ SGETTLGDLA       120
     VAESDCSSAR KKGDLGFFGR GEMQKEFEDA AFGLQPGQVS SVIETASGVH LIER             174
//

If you have problems or comments...

PBIL Back to PBIL home page