(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE412

PENCW_10.PE412       Location/Qualifiers
FT   CDS             join(complement(977216..977230),complement(977076..977163),
FT                   complement(976765..976989),complement(976634..976704))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000183702" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129529"
FT                   /orf_name="Pc13g04120"
FT                   /product="Pc13g04120 protein"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="large ribosomal subunit"
FT                   /protein_id="CAP91481.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015934"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="UniParc:UPI000183091E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H264"
FT                   /transl_table=1
FT                   /translation="MIQLKQTLLNCIDNSGASIVECVNVLKKKRPATIGDRIVVVVQKQ
FT                   RSAGSEATTAAALASKVRRGDIRHAVVVRVKKELQRPDGSLVRFGDNACVLVNKSGDPI
FT                   GTRMNGVVGQELRNKKWSKILSLAPIHV"
     MIQLKQTLLN CIDNSGASIV ECVNVLKKKR PATIGDRIVV VVQKQRSAGS EATTAAALAS        60
     KVRRGDIRHA VVVRVKKELQ RPDGSLVRFG DNACVLVNKS GDPIGTRMNG VVGQELRNKK       120
     WSKILSLAPI HV                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page