(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE413

PENCW_10.PE413       Location/Qualifiers
FT   CDS             join(978491..978604,978665..979665,979765..980584)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214006" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672470"
FT                   /orf_name="Pc13g04130"
FT                   /product="Pc13g04130 protein"
FT                   /protein_id="CAP91482.1"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniParc:UPI00018309F3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H269"
FT                   /transl_table=1
FT                   /translation="MPPKRARKSSPAAERRERLTLAKLASYDDVATDALVDHAYFWTTT
FT                   RKNRTKYSPARGIHDDDVGRILLEDVIVDKDIPKAERKLLELPGLKKYMTNLRSPREKE
FT                   WFRRHLRKYIQMYLPDCPFEVTTTNRYIITQHEAAICARRFIKKGEEIKHLSGTLVSMT
FT                   HEEELDLGLTRKDFSIVMSSRRRAPSFFLGPARFANHDCDANGSLTTRGNEGMSVLAMR
FT                   DIHEGEEITVSYGEDYFGIDNCECLCHTCEIAVRNGWSSHVDTETNSKESSPASEVTAT
FT                   EDTPAENSNVSRKRRRSSDMEEPDSSSTLSCSTPRKRAKFQRQVSKLREEISVSELTGE
FT                   SGSAPPRGSDSTPIQDTVLISNALLAETAPQVVARRGDLNGTNGTNSTIPTDCESLSST
FT                   ADQSHRSSTSTTPTTEDDIEPQIKTEDTTLQPSESKALNGKDHPDASPEGQHITTHPMD
FT                   IDPEEGLSDLSNSTKLDDDKVVDKPKKRKPRTKRRFIVDSVETESQVARFPGDYTKTPR
FT                   LLAQKYDRWVECQTCDTWFLQSNSYLTRRECPRCERHSKLYGFQWPSTDKGPDGEERVM
FT                   DHRTIHRFLSPDAQSRICRRDRGVSFGITPTPELSDTNTPETETSDVTESRRDARATRR
FT                   RTRELRMTM"
     MPPKRARKSS PAAERRERLT LAKLASYDDV ATDALVDHAY FWTTTRKNRT KYSPARGIHD        60
     DDVGRILLED VIVDKDIPKA ERKLLELPGL KKYMTNLRSP REKEWFRRHL RKYIQMYLPD       120
     CPFEVTTTNR YIITQHEAAI CARRFIKKGE EIKHLSGTLV SMTHEEELDL GLTRKDFSIV       180
     MSSRRRAPSF FLGPARFANH DCDANGSLTT RGNEGMSVLA MRDIHEGEEI TVSYGEDYFG       240
     IDNCECLCHT CEIAVRNGWS SHVDTETNSK ESSPASEVTA TEDTPAENSN VSRKRRRSSD       300
     MEEPDSSSTL SCSTPRKRAK FQRQVSKLRE EISVSELTGE SGSAPPRGSD STPIQDTVLI       360
     SNALLAETAP QVVARRGDLN GTNGTNSTIP TDCESLSSTA DQSHRSSTST TPTTEDDIEP       420
     QIKTEDTTLQ PSESKALNGK DHPDASPEGQ HITTHPMDID PEEGLSDLSN STKLDDDKVV       480
     DKPKKRKPRT KRRFIVDSVE TESQVARFPG DYTKTPRLLA QKYDRWVECQ TCDTWFLQSN       540
     SYLTRRECPR CERHSKLYGF QWPSTDKGPD GEERVMDHRT IHRFLSPDAQ SRICRRDRGV       600
     SFGITPTPEL SDTNTPETET SDVTESRRDA RATRRRTREL RMTM                        644
//

If you have problems or comments...

PBIL Back to PBIL home page