(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE414

PENCW_10.PE414       Location/Qualifiers
FT   CDS             join(981244..982599,982682..982893,982962..983022)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217588" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950896"
FT                   /orf_name="Pc13g04140"
FT                   /product="Pc13g04140 protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP91483.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="UniParc:UPI00018309F4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H270"
FT                   /transl_table=1
FT                   /translation="MRFSNLIATLLLGFGVTGSTAWDNPLVSLDYGSFQGQYDSTYNLS
FT                   YFRKIPFAAPPTGENRFRAPQPPLEVTEDVYDTNQDFDMCPQRTVNGTEDCLYLGLFSR
FT                   PWDLAKDTSRPVLVVFYGGAFVQGSAAFAMPPSSFPVLNVSNINDYIVIYSNYRVNAFG
FT                   FLPGKAIKDSHTSDLNPGLLDQQYVLKWVQKHIHRFGGNPHNVTIWGQSAGAGSVVAQV
FT                   LANGRHGQPKLFSKALASSPFWPKTYKYNAPEAEEIYSQLANLTGCASRHADKTLACLK
FT                   SVDVQKIRDASLIIGASNTWTTSSYTWAPVIDGTFLVETLTDTVNRRSLNTEFVWGMYN
FT                   SHEGENFVPSGLDSPVLENGFDSSLASFHQWLSGFVPGLSGKQIDEVETLYPAEGSTET
FT                   IDSYKSSYVRAGLVYRDVVLACPAYWIASAATERGHLGEYTISPAKHASDTIYWNKINA
FT                   VQETNPVVYKGYAGAFASFFQTGDPNAHKVTNASQPGVPELRTGEEFVVVEDRLENVKL
FT                   VQLKKRYFDSIGLGRRYTRKLVRYI"
     MRFSNLIATL LLGFGVTGST AWDNPLVSLD YGSFQGQYDS TYNLSYFRKI PFAAPPTGEN        60
     RFRAPQPPLE VTEDVYDTNQ DFDMCPQRTV NGTEDCLYLG LFSRPWDLAK DTSRPVLVVF       120
     YGGAFVQGSA AFAMPPSSFP VLNVSNINDY IVIYSNYRVN AFGFLPGKAI KDSHTSDLNP       180
     GLLDQQYVLK WVQKHIHRFG GNPHNVTIWG QSAGAGSVVA QVLANGRHGQ PKLFSKALAS       240
     SPFWPKTYKY NAPEAEEIYS QLANLTGCAS RHADKTLACL KSVDVQKIRD ASLIIGASNT       300
     WTTSSYTWAP VIDGTFLVET LTDTVNRRSL NTEFVWGMYN SHEGENFVPS GLDSPVLENG       360
     FDSSLASFHQ WLSGFVPGLS GKQIDEVETL YPAEGSTETI DSYKSSYVRA GLVYRDVVLA       420
     CPAYWIASAA TERGHLGEYT ISPAKHASDT IYWNKINAVQ ETNPVVYKGY AGAFASFFQT       480
     GDPNAHKVTN ASQPGVPELR TGEEFVVVED RLENVKLVQL KKRYFDSIGL GRRYTRKLVR       540
     YI                                                                      542
//

If you have problems or comments...

PBIL Back to PBIL home page