(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE415

PENCW_10.PE415       Location/Qualifiers
FT   CDS             complement(983205..985109)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048380" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978330"
FT                   /orf_name="Pc13g04150"
FT                   /product="Pc13g04150 protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAP91484.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI00018309F5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H248"
FT                   /transl_table=1
FT                   /translation="MPLPIRSSICFLCQTKATLIAPSILPTSWQTTRGMATVRLRRKAA
FT                   RMALSPTVSKPSLPSPNKPRRERPGPFASMNQTQARIRDTPRTRSQAALKRSGEEGKTE
FT                   KKESPLYKALKMQTTLTPVPYGRRSAIKARLADITSFDHFPLLPAVRQSIFAQALAGLT
FT                   DVTPTPIQRLAIPELLLDESKKKKKVKKANEDEEEYDFDQYLLAAETGSGKTLAYLLPI
FT                   VDAVKRAEVIDMQEEKALEEQKAREREERMKNKAFDLEPEEPPMTNAARPRAIILVPTS
FT                   ELVSQVGSQLKELAHTVKYRSGEISSTFTPRRIKNTLFHPAGIDILVSTPHLLGSVART
FT                   NPNILSRVTHLVLDEADSLMDRSFIPTTSEIIAKVAPSLKKLILCSATIPRSLDNQLRK
FT                   RFPDMQRLTTPNLHAIPRRVQLGVVDIEKEPYRGNRNLACADVIWSIGKAGDRHEHTET
FT                   WGPLNAYMEPKVKKIIVFVNEREEADEVARFLQSKGIDAVSLSRDTDSRKQQETLSQFT
FT                   EVKLPPTAEEIMINKKKNRAAGSIPFEFPERQEPIRRLPDTKVLVTTDIASRGIDTLAV
FT                   KTVVLYHVPHTTIDFIHRLGRLGRMGKRGRGVVLVGKKDRKDVVREVREGMFRGQALI"
     MPLPIRSSIC FLCQTKATLI APSILPTSWQ TTRGMATVRL RRKAARMALS PTVSKPSLPS        60
     PNKPRRERPG PFASMNQTQA RIRDTPRTRS QAALKRSGEE GKTEKKESPL YKALKMQTTL       120
     TPVPYGRRSA IKARLADITS FDHFPLLPAV RQSIFAQALA GLTDVTPTPI QRLAIPELLL       180
     DESKKKKKVK KANEDEEEYD FDQYLLAAET GSGKTLAYLL PIVDAVKRAE VIDMQEEKAL       240
     EEQKAREREE RMKNKAFDLE PEEPPMTNAA RPRAIILVPT SELVSQVGSQ LKELAHTVKY       300
     RSGEISSTFT PRRIKNTLFH PAGIDILVST PHLLGSVART NPNILSRVTH LVLDEADSLM       360
     DRSFIPTTSE IIAKVAPSLK KLILCSATIP RSLDNQLRKR FPDMQRLTTP NLHAIPRRVQ       420
     LGVVDIEKEP YRGNRNLACA DVIWSIGKAG DRHEHTETWG PLNAYMEPKV KKIIVFVNER       480
     EEADEVARFL QSKGIDAVSL SRDTDSRKQQ ETLSQFTEVK LPPTAEEIMI NKKKNRAAGS       540
     IPFEFPERQE PIRRLPDTKV LVTTDIASRG IDTLAVKTVV LYHVPHTTID FIHRLGRLGR       600
     MGKRGRGVVL VGKKDRKDVV REVREGMFRG QALI                                   634
//

If you have problems or comments...

PBIL Back to PBIL home page