(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE416

PENCW_10.PE416       Location/Qualifiers
FT   CDS             join(986834..986923,986975..989744,989799..990496,
FT                   990551..991174)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213995" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950897"
FT                   /orf_name="Pc13g04160"
FT                   /product="Pc13g04160 protein"
FT                   /protein_id="CAP91485.1"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR012966"
FT                   /db_xref="UniParc:UPI00018309F6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H249"
FT                   /transl_table=1
FT                   /translation="MGNGSGQRPLSEVSPMAQRRNSPSWNQVTKMPHGESPAYDVSSLN
FT                   NNNSPRLFWKGRDSPSPFPKGAENKAPYDPEGCYFPTKRPSLENLKRVSKVKNHSMFLE
FT                   GGQEYDPASVVFPHRPLASERSPQRDSQMNVAKSQFDEDTTQISRPSSPSKDQASPSKS
FT                   SLSKGSRYGKGFDPQNDIWSEYGSAGHRHAKSVTFDHAPPQVNEYEMTTPDLSSVASES
FT                   RENSYESDEEGDLSFEAESSIERDDSFDASLEDIEKTPVVLPEDWRFMSPSTNSDGDPF
FT                   VEDVEEDSTEGRPISREGGSSQHTRVESLDSNGERRPLPPLPSVNRTSGARPSSAGKLA
FT                   AAFELGSAGQRVLPSPPAAASYTKSDIPGAGSIEERLRLMMLQERDDDYEKYDDHAKNI
FT                   EEPLELPRADESLTSKDDTHKDDEAKENFFSPPRISRDSILRGIRKGDSYEDDSFDDSS
FT                   QIASSPNRYDHYDPDVPIPSMETDDDDSSSVIIKQEENDEDLYSITDYYQNRSDNSLSS
FT                   RDQRAKYDEDSNYSLRSAAEAAERKHAGYDGHKEGSGETTPNAESQADAQKSAPLNEDA
FT                   KACKEPNAPQDQSFDMASIRQSLARPLTPEMPQDQASEPSTPDSVIRHPIEDDHEEDDN
FT                   KEEEGEVEEEEEPELAHDESSSDESVPEPVATIRAPGAGLKTRPSLTPADMQSMAATRR
FT                   QISGQHAPPVPSLTKQISNDSNSSDREHKQTDSPPKLGLPTDLAQRQSSCLKLDIPFSI
FT                   QEESLGFGLDKEFDRVIESQKVAFHLALSQSPGSVPPSQAIAPNDCATPGNSAHPADSP
FT                   TPKQRGYLMRQNTKVIIASSRNEDEEALPSPERTAQDPRGTRSAGSSPRKPSQQTWTTV
FT                   PWNGSPRRPSIKPGNGVPKKKPVPGAGGVPPLPGQPSNVQEAPSTIGENEPAISESFED
FT                   GEERGRLFVKVVGLKYCDLPLPRGERSYFALTLDNGLHCVTTSWLEMGKSAPIGQEFEL
FT                   IVQNDLEFQLTLQMKIDESKFQTQEPAASPSRQKASALSRVFASPRRRKELDIKQQMQS
FT                   QQQKTKDVNAPVYERLRNLVARDGSFGRAYVALSDHEEQAFGRPHVVDVACFNEWAVEE
FT                   QMSSIKSKKSATSINTQRRPPYKIGKLEVQLLFVPKPKGSKDEDMPKSMNACIREMRDA
FT                   ESVASRSWEGFLSQQGGDCPYWRRRFFKLQGSKLTAFHETTRQPRATINLAKASKLIDD
FT                   RSSLLQKETSTKGGSRRKSAFAEEEDGYMFVEEGFRIRFGNGEVIDFYADSPADKEGWL
FT                   RVMSEAVGKGASSGNGALKPWADLVLKRERSMKTSNETAPRRPTSGIPTPAPPQSPVRS
FT                   RNSAMMGPPSSAGSGAPAPQSPRPRHKHTHSQPEIGSVEARRQKTRSLMF"
     MGNGSGQRPL SEVSPMAQRR NSPSWNQVTK MPHGESPAYD VSSLNNNNSP RLFWKGRDSP        60
     SPFPKGAENK APYDPEGCYF PTKRPSLENL KRVSKVKNHS MFLEGGQEYD PASVVFPHRP       120
     LASERSPQRD SQMNVAKSQF DEDTTQISRP SSPSKDQASP SKSSLSKGSR YGKGFDPQND       180
     IWSEYGSAGH RHAKSVTFDH APPQVNEYEM TTPDLSSVAS ESRENSYESD EEGDLSFEAE       240
     SSIERDDSFD ASLEDIEKTP VVLPEDWRFM SPSTNSDGDP FVEDVEEDST EGRPISREGG       300
     SSQHTRVESL DSNGERRPLP PLPSVNRTSG ARPSSAGKLA AAFELGSAGQ RVLPSPPAAA       360
     SYTKSDIPGA GSIEERLRLM MLQERDDDYE KYDDHAKNIE EPLELPRADE SLTSKDDTHK       420
     DDEAKENFFS PPRISRDSIL RGIRKGDSYE DDSFDDSSQI ASSPNRYDHY DPDVPIPSME       480
     TDDDDSSSVI IKQEENDEDL YSITDYYQNR SDNSLSSRDQ RAKYDEDSNY SLRSAAEAAE       540
     RKHAGYDGHK EGSGETTPNA ESQADAQKSA PLNEDAKACK EPNAPQDQSF DMASIRQSLA       600
     RPLTPEMPQD QASEPSTPDS VIRHPIEDDH EEDDNKEEEG EVEEEEEPEL AHDESSSDES       660
     VPEPVATIRA PGAGLKTRPS LTPADMQSMA ATRRQISGQH APPVPSLTKQ ISNDSNSSDR       720
     EHKQTDSPPK LGLPTDLAQR QSSCLKLDIP FSIQEESLGF GLDKEFDRVI ESQKVAFHLA       780
     LSQSPGSVPP SQAIAPNDCA TPGNSAHPAD SPTPKQRGYL MRQNTKVIIA SSRNEDEEAL       840
     PSPERTAQDP RGTRSAGSSP RKPSQQTWTT VPWNGSPRRP SIKPGNGVPK KKPVPGAGGV       900
     PPLPGQPSNV QEAPSTIGEN EPAISESFED GEERGRLFVK VVGLKYCDLP LPRGERSYFA       960
     LTLDNGLHCV TTSWLEMGKS APIGQEFELI VQNDLEFQLT LQMKIDESKF QTQEPAASPS      1020
     RQKASALSRV FASPRRRKEL DIKQQMQSQQ QKTKDVNAPV YERLRNLVAR DGSFGRAYVA      1080
     LSDHEEQAFG RPHVVDVACF NEWAVEEQMS SIKSKKSATS INTQRRPPYK IGKLEVQLLF      1140
     VPKPKGSKDE DMPKSMNACI REMRDAESVA SRSWEGFLSQ QGGDCPYWRR RFFKLQGSKL      1200
     TAFHETTRQP RATINLAKAS KLIDDRSSLL QKETSTKGGS RRKSAFAEEE DGYMFVEEGF      1260
     RIRFGNGEVI DFYADSPADK EGWLRVMSEA VGKGASSGNG ALKPWADLVL KRERSMKTSN      1320
     ETAPRRPTSG IPTPAPPQSP VRSRNSAMMG PPSSAGSGAP APQSPRPRHK HTHSQPEIGS      1380
     VEARRQKTRS LMF                                                         1393
//

If you have problems or comments...

PBIL Back to PBIL home page