(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE418

PENCW_10.PE418       Location/Qualifiers
FT   CDS             993806..994750
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187209" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672471"
FT                   /orf_name="Pc13g04180"
FT                   /product="Pc13g04180 protein"
FT                   /protein_id="CAP91487.1"
FT                   /db_xref="UniParc:UPI00018309F8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H251"
FT                   /transl_table=1
FT                   /translation="MASAAVQLPASHGYLLSEKPGVPVSEKPHHVQTTLNFFKENEDGS
FT                   PPAPTYTSRPETYDRPAVSLAATIHDISGHELDYKLDTHGFQLYYHESQEKDFLDDEKI
FT                   KREYYAETEQLLKDAYATPKPISSHKTNIDLRSTGASRIFIFDHTIRRAPTDGSVGVRL
FT                   RGPVQRVHIDQSYTASKNRVSHHLPDEAAELLKGRYQIINVWRPIKTILKDPLAVADAH
FT                   SVPDSDLVPIGLIYPDREGETYGVKPDPNIKWYYRYGQTPDLVTLIKCFDSKVDGRARR
FT                   VPHTAFVNPETENEAGRESIEVRALVFHPDDRD"
     MASAAVQLPA SHGYLLSEKP GVPVSEKPHH VQTTLNFFKE NEDGSPPAPT YTSRPETYDR        60
     PAVSLAATIH DISGHELDYK LDTHGFQLYY HESQEKDFLD DEKIKREYYA ETEQLLKDAY       120
     ATPKPISSHK TNIDLRSTGA SRIFIFDHTI RRAPTDGSVG VRLRGPVQRV HIDQSYTASK       180
     NRVSHHLPDE AAELLKGRYQ IINVWRPIKT ILKDPLAVAD AHSVPDSDLV PIGLIYPDRE       240
     GETYGVKPDP NIKWYYRYGQ TPDLVTLIKC FDSKVDGRAR RVPHTAFVNP ETENEAGRES       300
     IEVRALVFHP DDRD                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page