(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE419

PENCW_10.PE419       Location/Qualifiers
FT   CDS             complement(995125..996000)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234957" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825164"
FT                   /orf_name="Pc13g04190"
FT                   /product="Pc13g04190 protein"
FT                   /protein_id="CAP91488.1"
FT                   /db_xref="InterPro:IPR008547"
FT                   /db_xref="UniParc:UPI00018309F9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H245"
FT                   /transl_table=1
FT                   /translation="MAPQPIPFPGFTPISDRVYLRNGHEKSKPAPADEPTTIIISGWGD
FT                   GMPKHVTKYSDGYHELYPSARIIVILSRTFQATNQPEEVRIQAMMPVVDTVFPTPTGSG
FT                   NEKERVLVHAMSNTGAIFTASTVIAYQRRHGADKPFPHQLLVLDSTPGSLDFRSQATRW
FT                   SRAMAVGTAKFFPWPFVITHGLWYAFLWANYLWQVLRGAVSSGVWADRIINDKACVATD
FT                   SSRVYLYSKEDEIIGYKDLEENVAHTKTLGYSVDLEMFEGSSHVGHMRLHPEQYWNKIS
FT                   SSWKQAIAEK"
     MAPQPIPFPG FTPISDRVYL RNGHEKSKPA PADEPTTIII SGWGDGMPKH VTKYSDGYHE        60
     LYPSARIIVI LSRTFQATNQ PEEVRIQAMM PVVDTVFPTP TGSGNEKERV LVHAMSNTGA       120
     IFTASTVIAY QRRHGADKPF PHQLLVLDST PGSLDFRSQA TRWSRAMAVG TAKFFPWPFV       180
     ITHGLWYAFL WANYLWQVLR GAVSSGVWAD RIINDKACVA TDSSRVYLYS KEDEIIGYKD       240
     LEENVAHTKT LGYSVDLEMF EGSSHVGHMR LHPEQYWNKI SSSWKQAIAE K                291
//

If you have problems or comments...

PBIL Back to PBIL home page