(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE42

PENCW_10.PE42        Location/Qualifiers
FT   CDS             join(104179..104213,104329..104391,104641..104771,
FT                   104827..105072,105124..105165,105326..105564,1
FT                   05615..105734)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948697"
FT                   /orf_name="Pc13g00420"
FT                   /product="Putative uncharacterized protein Pc13g00420 "
FT                   /protein_id="CAP91111.1"
FT                   /db_xref="UniParc:UPI0001830E90"
FT                   /db_xref="UniProtKB/TrEMBL:B6H170"
FT                   /transl_table=1
FT                   /translation="MKLLPKMSRDNNSLLGESLSLPEYLACWCEDLTCSVPGSGKLVPG
FT                   IQVCVPGGFWAPRNTRPVPRDIHSAPRRRLGVHDITSNPVARNPAYKFNPVPVHLHVAR
FT                   TAAIMQVSPKVHTALATVLLIVSLVRLELSRRAARGISHLALDLAVSVPKDVLLGNTWD
FT                   IQRLSVLTRATLVGIYVYLPLQHAVLFLHFVDYLSLAYLLWSLDEYTTAGSRTGLQLRC
FT                   ALHWTMGLAAVLLLIAVFGVVLYCWLLSLELQLCILTIWMILSYYSVRSAGSSVDEQST
FT                   CSATVVVREV"
     MKLLPKMSRD NNSLLGESLS LPEYLACWCE DLTCSVPGSG KLVPGIQVCV PGGFWAPRNT        60
     RPVPRDIHSA PRRRLGVHDI TSNPVARNPA YKFNPVPVHL HVARTAAIMQ VSPKVHTALA       120
     TVLLIVSLVR LELSRRAARG ISHLALDLAV SVPKDVLLGN TWDIQRLSVL TRATLVGIYV       180
     YLPLQHAVLF LHFVDYLSLA YLLWSLDEYT TAGSRTGLQL RCALHWTMGL AAVLLLIAVF       240
     GVVLYCWLLS LELQLCILTI WMILSYYSVR SAGSSVDEQS TCSATVVVRE V                291
//

If you have problems or comments...

PBIL Back to PBIL home page