(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE420

PENCW_10.PE420       Location/Qualifiers
FT   CDS             join(997568..997755,997854..997965,998016..998728,
FT                   998777..1000166)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000182535" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950898"
FT                   /orf_name="Pc13g04200"
FT                   /product="Pc13g04200 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91489.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI00018309FA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H246"
FT                   /transl_table=1
FT                   /translation="MKVAIPRQRFIVAPPSNKRVSRACETCRQRKIKCNGKTPTCRQCE
FT                   ETNSSCVYPLKSRERTTRQIESFHQQVQDYESMLKDIGNLVDGQSAKRIKDLLQKYNAD
FT                   SDDGSNSTPDVSHDRNGSKRSPSPSSVGSLEAVDRVEEDLNLTESSRATGYMGKSSEIT
FT                   WMGRVQEGTEQRSRGQSPKAASEDHTNDKVAPSAVNYHIDDIGVDAPGPVQMYWVPPRQ
FT                   VADHLFETYLRAVHPHFPIINSTLFSTQYRDFFDDRSYPGDKWLAILNMIFAIAAEYLY
FT                   NSDGTQRGDIKDHLFYLTRARMLSMGGDSLFEHPDLQQVQIEGLIAFHMLSTNQVNRAW
FT                   KISALAIRSATSLGINLKSSCHKMLGVSKEIGCRIWWCLYTVEHTLGSMTGRATSISTN
FT                   MYTTQLPLPFDEDHLPEPTATMLLGDLDERAKRVDMAMTSPYIRHPDLQPSEDTPAARS
FT                   WLQSLPVNPSLYFLYYCDLAVVNQEILDHVYSPESATISWEDIKSRTSRLRTTVDAWVS
FT                   SLPPGLDFASVKDENQQSYWAKTNLAFHYYNTRIMLGRPSLCRHSRADRGRKSVEQRGF
FT                   SHDMAVMTLESAMHMLDLLPNKPSMRHIYRFCPWWCFLHYIMKTATVIILELSFHCVHA
FT                   PDRESDLVESAKKSVRWLHMMSINCIASHRAWQLCESAVRRLVSSMGYDDSDIPPPPKR
FT                   QRGDQFGDNGAVPPGQHNGTAGGGQVLPYNGQGQSSVLPHESHAMDHSNNNPDLTGSLA
FT                   FGFLATPSSQDHTDGYFPYDPISEEFLRYFFPALDGEANPSGERNTF"
     MKVAIPRQRF IVAPPSNKRV SRACETCRQR KIKCNGKTPT CRQCEETNSS CVYPLKSRER        60
     TTRQIESFHQ QVQDYESMLK DIGNLVDGQS AKRIKDLLQK YNADSDDGSN STPDVSHDRN       120
     GSKRSPSPSS VGSLEAVDRV EEDLNLTESS RATGYMGKSS EITWMGRVQE GTEQRSRGQS       180
     PKAASEDHTN DKVAPSAVNY HIDDIGVDAP GPVQMYWVPP RQVADHLFET YLRAVHPHFP       240
     IINSTLFSTQ YRDFFDDRSY PGDKWLAILN MIFAIAAEYL YNSDGTQRGD IKDHLFYLTR       300
     ARMLSMGGDS LFEHPDLQQV QIEGLIAFHM LSTNQVNRAW KISALAIRSA TSLGINLKSS       360
     CHKMLGVSKE IGCRIWWCLY TVEHTLGSMT GRATSISTNM YTTQLPLPFD EDHLPEPTAT       420
     MLLGDLDERA KRVDMAMTSP YIRHPDLQPS EDTPAARSWL QSLPVNPSLY FLYYCDLAVV       480
     NQEILDHVYS PESATISWED IKSRTSRLRT TVDAWVSSLP PGLDFASVKD ENQQSYWAKT       540
     NLAFHYYNTR IMLGRPSLCR HSRADRGRKS VEQRGFSHDM AVMTLESAMH MLDLLPNKPS       600
     MRHIYRFCPW WCFLHYIMKT ATVIILELSF HCVHAPDRES DLVESAKKSV RWLHMMSINC       660
     IASHRAWQLC ESAVRRLVSS MGYDDSDIPP PPKRQRGDQF GDNGAVPPGQ HNGTAGGGQV       720
     LPYNGQGQSS VLPHESHAMD HSNNNPDLTG SLAFGFLATP SSQDHTDGYF PYDPISEEFL       780
     RYFFPALDGE ANPSGERNTF                                                   800
//

If you have problems or comments...

PBIL Back to PBIL home page