(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE421

PENCW_10.PE421       Location/Qualifiers
FT   CDS             join(complement(1000982..1001061),
FT                   complement(1000308..1000869))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950899"
FT                   /orf_name="Pc13g04210"
FT                   /product="Pc13g04210 protein"
FT                   /protein_id="CAP91490.1"
FT                   /db_xref="UniParc:UPI00018309FB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H247"
FT                   /transl_table=1
FT                   /translation="MSPTYKKMFEARQTFKPVRRYGQPDGRKPSREKSEYWKNSQRTTE
FT                   NDEDEERLRLCYEELETVKRNHSQNEQKMFADESMIPPGPLKRDYDAMRQDPTWYLRKE
FT                   LIEDCFGRGCCCARGCDCCRNRASAYYKRGVGHCTTDCGCCASERGFEYTAGEKQQIVE
FT                   QFDKMLRSRNPSYIVKMAEAYFVKPLEQKVLEQVQKKKVQKKRVWWKQLL"
     MSPTYKKMFE ARQTFKPVRR YGQPDGRKPS REKSEYWKNS QRTTENDEDE ERLRLCYEEL        60
     ETVKRNHSQN EQKMFADESM IPPGPLKRDY DAMRQDPTWY LRKELIEDCF GRGCCCARGC       120
     DCCRNRASAY YKRGVGHCTT DCGCCASERG FEYTAGEKQQ IVEQFDKMLR SRNPSYIVKM       180
     AEAYFVKPLE QKVLEQVQKK KVQKKRVWWK QLL                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page