(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE422

PENCW_10.PE422       Location/Qualifiers
FT   CDS             join(complement(1002903..1003218),
FT                   complement(1002354..1002486),complement(1002209..1002302),
FT                   complement(1002094..1002153),complement(1001794..1002030),
FT                   complement(1001425..1001724))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000185578" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129531"
FT                   /orf_name="Pc13g04220"
FT                   /product="Pc13g04220 protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP91491.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR013831"
FT                   /db_xref="UniParc:UPI00018309FC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H271"
FT                   /transl_table=1
FT                   /translation="MRLGRTFTTFLSWALVASATILENGQVRENSYPGQLEPVTLDDSW
FT                   RDYPADAPEISYKGRWDSQHISCMFPIRFLFPRLLFLTLTLTLERTSGWSYVLQLSPIL
FT                   SLSPCRSTCSSLTIHTVQIAGVAVAKDAVLTKPPTFEKRVEIIGGSLASGQFATYETIS
FT                   SWSFLFANGLGNVEYGITAYPGVCLADEQCYGGSSRGVGWYWHRASDPGSRARAMYDHS
FT                   PEKWDVKAEQPADLVIIQMGGNDHRHPNEIPGRDYYHAYVELVEDIHSNWPNAIILLMS
FT                   QWGTFSKEGKKYVGSTYYQEETRQVNEHFKDRGFVYYFPTEGLLQHNDINPKNHLTDVG
FT                   HIKVASHLLQWVKLVLRWNLEPTGEVQSGTTYWNDQQEY"
     MRLGRTFTTF LSWALVASAT ILENGQVREN SYPGQLEPVT LDDSWRDYPA DAPEISYKGR        60
     WDSQHISCMF PIRFLFPRLL FLTLTLTLER TSGWSYVLQL SPILSLSPCR STCSSLTIHT       120
     VQIAGVAVAK DAVLTKPPTF EKRVEIIGGS LASGQFATYE TISSWSFLFA NGLGNVEYGI       180
     TAYPGVCLAD EQCYGGSSRG VGWYWHRASD PGSRARAMYD HSPEKWDVKA EQPADLVIIQ       240
     MGGNDHRHPN EIPGRDYYHA YVELVEDIHS NWPNAIILLM SQWGTFSKEG KKYVGSTYYQ       300
     EETRQVNEHF KDRGFVYYFP TEGLLQHNDI NPKNHLTDVG HIKVASHLLQ WVKLVLRWNL       360
     EPTGEVQSGT TYWNDQQEY                                                    379
//

If you have problems or comments...

PBIL Back to PBIL home page