(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE423

PENCW_10.PE423       Location/Qualifiers
FT   CDS             join(1005634..1005747,1005799..1006426,1006481..1007184)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076581" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950900"
FT                   /orf_name="Pc13g04230"
FT                   /product="Pc13g04230 protein"
FT                   /function="transferase activity, transferring acyl groups
FT                   other than amino-acyl groups"
FT                   /protein_id="CAP91492.1"
FT                   /db_xref="GO:0016747"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniParc:UPI00018309FD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H272"
FT                   /transl_table=1
FT                   /translation="MEYIQPNHLYSRILDNIPWKSADPSVKGDPRKSVKWIDGLRGIAS
FT                   FLVILTHLARAWDYDLFAPRDDVDKPPRILQWPVFRIPWQGRLGVTIFAFLTGYVCALK
FT                   PLKQSRNGDILGSFTSVGKSAFRRPPRLIFPATIALIISWVMAQCGAFIAANRSDCWWC
FT                   RYAAVDLAPTFWEEFVRLFKTFLEVWTTGYMAYDDHQWALLPLLQASMLIYILVCATMF
FT                   CKFRFRVAIYLGMYLYFHQNAAKNTETFQMQAIYGMFLSDLSYEKGFKEFVERHSWGRK
FT                   IVAGILLCLGLFICSYPGEHPEWATWSSYMEQASHYIFPPKVNVGKRYSALGVDLIIFA
FT                   IYISPSTKEFLSSSLLLWLGKQSFAVYLVHGTLLRTVLCWMLYGITGQPWEGDIVDEKG
FT                   NPIYGEDGEPLHPHWIPIRAPWVVAISIPSWIVLVYFCATLWTGYVDPFCARMAQKLEK
FT                   WMFEEDEQAPPPLPMTSIPMQTA"
     MEYIQPNHLY SRILDNIPWK SADPSVKGDP RKSVKWIDGL RGIASFLVIL THLARAWDYD        60
     LFAPRDDVDK PPRILQWPVF RIPWQGRLGV TIFAFLTGYV CALKPLKQSR NGDILGSFTS       120
     VGKSAFRRPP RLIFPATIAL IISWVMAQCG AFIAANRSDC WWCRYAAVDL APTFWEEFVR       180
     LFKTFLEVWT TGYMAYDDHQ WALLPLLQAS MLIYILVCAT MFCKFRFRVA IYLGMYLYFH       240
     QNAAKNTETF QMQAIYGMFL SDLSYEKGFK EFVERHSWGR KIVAGILLCL GLFICSYPGE       300
     HPEWATWSSY MEQASHYIFP PKVNVGKRYS ALGVDLIIFA IYISPSTKEF LSSSLLLWLG       360
     KQSFAVYLVH GTLLRTVLCW MLYGITGQPW EGDIVDEKGN PIYGEDGEPL HPHWIPIRAP       420
     WVVAISIPSW IVLVYFCATL WTGYVDPFCA RMAQKLEKWM FEEDEQAPPP LPMTSIPMQT       480
     A                                                                       481
//

If you have problems or comments...

PBIL Back to PBIL home page