(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE425

PENCW_10.PE425       Location/Qualifiers
FT   CDS             join(complement(1010944..1010967),
FT                   complement(1010611..1010718),complement(1010487..1010547),
FT                   complement(1010197..1010381))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825165"
FT                   /orf_name="Pc13g04250"
FT                   /product="Putative uncharacterized protein Pc13g04250 "
FT                   /protein_id="CAP91494.1"
FT                   /db_xref="UniParc:UPI00018309FF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H274"
FT                   /transl_table=1
FT                   /translation="MADDSQHPLWCKHCEVEGHLVIHCHALYEELTNFDAAFKMAQGQA
FT                   SDPKNAYPVARWGQAKKKKDVSVPGINCPSNPFAHLSPWEADTLANYPEQQWAYWMQWE
FT                   ADALASYLDQKWTYFLQWHAA"
     MADDSQHPLW CKHCEVEGHL VIHCHALYEE LTNFDAAFKM AQGQASDPKN AYPVARWGQA        60
     KKKKDVSVPG INCPSNPFAH LSPWEADTLA NYPEQQWAYW MQWEADALAS YLDQKWTYFL       120
     QWHAA                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page