(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE426

PENCW_10.PE426       Location/Qualifiers
FT   CDS             join(complement(1016455..1016788),
FT                   complement(1016062..1016396))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158704" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129532"
FT                   /orf_name="Pc13g04260"
FT                   /product="Pc13g04260 protein"
FT                   /protein_id="CAP91495.1"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniParc:UPI0001830ACF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H281"
FT                   /transl_table=1
FT                   /translation="MTEPSQPPVPEEPPNAVLNDSRPTSARDSRDDDREALELHTIQTR
FT                   EDDELDYSTASASSGEEHRVPTNRITSRPDSQRRLEARKGLWGKICRLWTRNVVITVPQ
FT                   KSNRDHFALERTFLAYIRTSTVIAMQGVLVAQLFRLQRPPEKANRHRLTFYELGIPLSV
FT                   ACHIVAVIVALIGAVRFFRQQNAIVRGKVHAGGWELYSVGFLLFLVSSFSLGRCWISGF
FT                   "
     MTEPSQPPVP EEPPNAVLND SRPTSARDSR DDDREALELH TIQTREDDEL DYSTASASSG        60
     EEHRVPTNRI TSRPDSQRRL EARKGLWGKI CRLWTRNVVI TVPQKSNRDH FALERTFLAY       120
     IRTSTVIAMQ GVLVAQLFRL QRPPEKANRH RLTFYELGIP LSVACHIVAV IVALIGAVRF       180
     FRQQNAIVRG KVHAGGWELY SVGFLLFLVS SFSLGRCWIS GF                          222
//

If you have problems or comments...

PBIL Back to PBIL home page