(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE427

PENCW_10.PE427       Location/Qualifiers
FT   CDS             1018213..1020765
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000251716" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129533"
FT                   /orf_name="Pc13g04270"
FT                   /product="Pc13g04270 protein"
FT                   /function="aminomethyltransferase activity"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="glycine catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP91496.1"
FT                   /db_xref="GO:0004047"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006546"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="UniParc:UPI0001830AD0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H282"
FT                   /transl_table=1
FT                   /translation="MSLSQRVVIIGAGIVGTNLADELVSRGWSDITVVEQGPLHMPGGS
FT                   TSHAPGLVFQTSPSKTMTHLARYTVEKLLSIEKDGHKCFNQVGGLEVATTPARLEDLKR
FT                   KHGYASSWGIEARLVSAEECYKMYPHLNNEMVLGGLHIPSDGLALAARATQLLIERTSK
FT                   AGVRYLGHTPVTGIERDGRRVTGVSTPSGTIPADIVVSCAGFWGVELGAMVGVEIPLLP
FT                   LAHQYAKTTAVPALAGRGINNMINGMNATLPILRHQDKRLYYREHGGQYGIGYYGHRPM
FT                   PVVAASLGLTPKEVDEKNMPSRLEFTTEDFDPAWKESQKLLPALQNTEIADGFNGVFSF
FT                   TPDGGPILGQPSHLDGFYVAEAVWVTHSAGVARALAQILTTGRSDIDVSECELSRFEEV
FT                   QLNRDYVSETGQQNFVEIYDIIHPLQQRESPRNLRVSPFYAREVELGAVFFETGGWERP
FT                   WWYEANKDLVKSLPPSWQPVERDSWSAQLHSPISAAEAWKTRNAVAMFDMTAFHRFDVR
FT                   GPGAVGLLQRLTTSDITTKPGTVTYTLLLNDHGGIRGDIFVLRLDDDVFQIGANTATDL
FT                   AYLTREARVHEQNTPGQWTEVRDVTGSTCCIGLWGPRARDVIAGITTVDVSNKGLPYFS
FT                   LKKTVIQGIPVTLIRKSYVGELGWEVQTSAEYGQRLWDTIWQAGKLHGLIAGGRSAFNS
FT                   MRLEKGYRTYGVDMTTEHNPFEAGVSYAVDANKKDDFVGKAALQRLSKQVPSRRLRALT
FT                   VDDGRSMILGKEPVFHNGKAAGYVTTAAFGYTIGKPIAYAWLPGYLREGETVEIEYFGK
FT                   RIRATVEAESLYDPEMNRLRQDSLPSATGPETAFMSRL"
     MSLSQRVVII GAGIVGTNLA DELVSRGWSD ITVVEQGPLH MPGGSTSHAP GLVFQTSPSK        60
     TMTHLARYTV EKLLSIEKDG HKCFNQVGGL EVATTPARLE DLKRKHGYAS SWGIEARLVS       120
     AEECYKMYPH LNNEMVLGGL HIPSDGLALA ARATQLLIER TSKAGVRYLG HTPVTGIERD       180
     GRRVTGVSTP SGTIPADIVV SCAGFWGVEL GAMVGVEIPL LPLAHQYAKT TAVPALAGRG       240
     INNMINGMNA TLPILRHQDK RLYYREHGGQ YGIGYYGHRP MPVVAASLGL TPKEVDEKNM       300
     PSRLEFTTED FDPAWKESQK LLPALQNTEI ADGFNGVFSF TPDGGPILGQ PSHLDGFYVA       360
     EAVWVTHSAG VARALAQILT TGRSDIDVSE CELSRFEEVQ LNRDYVSETG QQNFVEIYDI       420
     IHPLQQRESP RNLRVSPFYA REVELGAVFF ETGGWERPWW YEANKDLVKS LPPSWQPVER       480
     DSWSAQLHSP ISAAEAWKTR NAVAMFDMTA FHRFDVRGPG AVGLLQRLTT SDITTKPGTV       540
     TYTLLLNDHG GIRGDIFVLR LDDDVFQIGA NTATDLAYLT REARVHEQNT PGQWTEVRDV       600
     TGSTCCIGLW GPRARDVIAG ITTVDVSNKG LPYFSLKKTV IQGIPVTLIR KSYVGELGWE       660
     VQTSAEYGQR LWDTIWQAGK LHGLIAGGRS AFNSMRLEKG YRTYGVDMTT EHNPFEAGVS       720
     YAVDANKKDD FVGKAALQRL SKQVPSRRLR ALTVDDGRSM ILGKEPVFHN GKAAGYVTTA       780
     AFGYTIGKPI AYAWLPGYLR EGETVEIEYF GKRIRATVEA ESLYDPEMNR LRQDSLPSAT       840
     GPETAFMSRL                                                              850
//

If you have problems or comments...

PBIL Back to PBIL home page