(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE428

PENCW_10.PE428       Location/Qualifiers
FT   CDS             join(complement(1022513..1022743),
FT                   complement(1022111..1022405),complement(1021054..1022057))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15950902"
FT                   /orf_name="Pc13g04280"
FT                   /product="Putative uncharacterized protein Pc13g04280 "
FT                   /protein_id="CAP91497.1"
FT                   /db_xref="UniParc:UPI0001830AD1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H283"
FT                   /transl_table=1
FT                   /translation="MVTSSIFPLEIWLMIFQYLRDEESPQHISRLAQTCKSFHQELNHL
FT                   LYHPVRLRRVENARHFANTISSRPDLAALVKENLPPSDDGHTPQAEVQAVFTDIYYQNQ
FT                   DFHMRDCEDDLLALMMWMDDKGYPLGDASDPFGLGFNPLGHFSFQSWAEDLSEYTYFGQ
FT                   NYLKDLIPALQTCHIGTDSDLDPIHNAGKYQPYVEFNETIFTLPHLRKLCITGVTFRDF
FT                   GLKDELIEHRTTNLKELLLLNCGISTENLELIIRFPRALERLTIRVPVSLLSEYEEEDY
FT                   LSFSGELSARHAESLEYLDLDIYGGLDVGFGLDYFDVLKEIVITPHSVIKDHDGETVLT
FT                   SSLQRLTIRYEEGTGLLLDDIFNQVETAKLPNLRSVICQIPDNLCEGTTSSAVRVEAEA
FT                   FKSLFKDLGVELSTELVPYPLTMPKYDVCPCENLTFYHQFPFHPRPKPRPQNVPASYSN
FT                   PMPMPVVHDSDPYDGDYPYLYDMSPPSPPRMPTSMPTFMDYDDYLDWMYGG"
     MVTSSIFPLE IWLMIFQYLR DEESPQHISR LAQTCKSFHQ ELNHLLYHPV RLRRVENARH        60
     FANTISSRPD LAALVKENLP PSDDGHTPQA EVQAVFTDIY YQNQDFHMRD CEDDLLALMM       120
     WMDDKGYPLG DASDPFGLGF NPLGHFSFQS WAEDLSEYTY FGQNYLKDLI PALQTCHIGT       180
     DSDLDPIHNA GKYQPYVEFN ETIFTLPHLR KLCITGVTFR DFGLKDELIE HRTTNLKELL       240
     LLNCGISTEN LELIIRFPRA LERLTIRVPV SLLSEYEEED YLSFSGELSA RHAESLEYLD       300
     LDIYGGLDVG FGLDYFDVLK EIVITPHSVI KDHDGETVLT SSLQRLTIRY EEGTGLLLDD       360
     IFNQVETAKL PNLRSVICQI PDNLCEGTTS SAVRVEAEAF KSLFKDLGVE LSTELVPYPL       420
     TMPKYDVCPC ENLTFYHQFP FHPRPKPRPQ NVPASYSNPM PMPVVHDSDP YDGDYPYLYD       480
     MSPPSPPRMP TSMPTFMDYD DYLDWMYGG                                         509
//

If you have problems or comments...

PBIL Back to PBIL home page