(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE429

PENCW_10.PE429       Location/Qualifiers
FT   CDS             join(1023443..1023682,1023757..1023840,1023896..1024036,
FT                   1024088..1024192,1024256..1024675,1024733..1024790,
FT                   1024844..1025125,1025181..1025240,1025302..1025678)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181235" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19825166"
FT                   /orf_name="Pc13g04290"
FT                   /product="Pc13g04290 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP91498.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001830AD2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H284"
FT                   /transl_table=1
FT                   /translation="MSLVNEVNVDRVSGDSKNPRNEAVPLGEPVSLMGQGSPGVRRIEI
FT                   ITSYFRFWDRVFLFLAVFLIAYVYGLDGTVRYTYQPYATQFYGQHSLLATINVLRAVIA
FT                   AAAQPTAAKVADVFGRVELILVSILFYTVGTIVESCALTLSGFAAGAVIYQIGYTSIML
FT                   LVEVLVADVTSSRSRLLFSYVPAMPFIINTWISGNLTSAVLKTTTWQWGIGMFAIIYPV
FT                   CAIPLIVVLFIVHRRAKKSGALESYKSSLQLLGKRQLALELFWHLDIVGNILLIAMLAC
FT                   ILVPFTLAGGVTAQWKTAKVIAPLVIGVLLIPVWIFWERTCQHPMLPFKLLKDRAVWGA
FT                   LGIPIMLNTAWYLQGDFLYTVLYVSFGESVLSATRITQLYSFVSVITGVILGLIVMKVR
FT                   QLKPFIVAGTLLFMVAFGILIYFRGGVADSSHSGVIGAQVLLGIAGGMFPYPAQASIQV
FT                   ASKHEHLAVITGLYLAAYNVGSALGNTISGAIWNQVLPSELNYRLGNETLAAYVYAKPL
FT                   EFAAVNPVGTPDRDNVILAYQKTQRLLCITGICLTVPLIAFALVIRNPTLTKEQSLAKA
FT                   EEESSDSDFSPR"
     MSLVNEVNVD RVSGDSKNPR NEAVPLGEPV SLMGQGSPGV RRIEIITSYF RFWDRVFLFL        60
     AVFLIAYVYG LDGTVRYTYQ PYATQFYGQH SLLATINVLR AVIAAAAQPT AAKVADVFGR       120
     VELILVSILF YTVGTIVESC ALTLSGFAAG AVIYQIGYTS IMLLVEVLVA DVTSSRSRLL       180
     FSYVPAMPFI INTWISGNLT SAVLKTTTWQ WGIGMFAIIY PVCAIPLIVV LFIVHRRAKK       240
     SGALESYKSS LQLLGKRQLA LELFWHLDIV GNILLIAMLA CILVPFTLAG GVTAQWKTAK       300
     VIAPLVIGVL LIPVWIFWER TCQHPMLPFK LLKDRAVWGA LGIPIMLNTA WYLQGDFLYT       360
     VLYVSFGESV LSATRITQLY SFVSVITGVI LGLIVMKVRQ LKPFIVAGTL LFMVAFGILI       420
     YFRGGVADSS HSGVIGAQVL LGIAGGMFPY PAQASIQVAS KHEHLAVITG LYLAAYNVGS       480
     ALGNTISGAI WNQVLPSELN YRLGNETLAA YVYAKPLEFA AVNPVGTPDR DNVILAYQKT       540
     QRLLCITGIC LTVPLIAFAL VIRNPTLTKE QSLAKAEEES SDSDFSPR                    588
//

If you have problems or comments...

PBIL Back to PBIL home page